ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

597

Name

BCL2A1

Synonym

ACC-1|ACC-2|ACC1|ACC2|BCL2L5|BFL1|GRS|HBPA1;BCL2-related protein A1;BCL2A1;BCL2-related protein A1

Definition

bcl-2-like protein 5|bcl-2-related protein A1|bcl2-L-5|hematopoietic BCL2-related protein A1|hemopoietic-specific early response protein|protein BFL-1

Position

15q24.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

BCR signaling pathway;PID Curated;200005

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

Direct p53 effectors;PID Curated;200101

Disease

Tuberculosis;FunDO

Disease

Dermatitis;FunDO

Disease

Prostate cancer;FunDO

Disease

Leukemia;FunDO

Disease

Advanced cancer;FunDO

Disease

Breast cancer;FunDO

External Links

Links to cell senescence gene database

597

Links to epithelial mesenchymal transition gene database

597

Links to ovarian cancer gene database

597

Links to endometrial cancer gene database

597

Links to iHOP

597

Sequence Information

Nucleotide Sequence

>597 : length: 955
AGCCTACGCACGAAAGTGACTAGGAGGAAGGATATTATAAAGTGATGCAAACAGAAATTC
CACCAGCCTCCATGTATCATCATGTGTCATAACTCAGTCAAGCTCAGTGAGCATTCTCAG
CACATTGCCTCAACAGCTTCAAGGTGAGCCAGCTCAAGACTTTGCTCTCCACCAGGCAGA
AGATGACAGACTGTGAATTTGGATATATTTACAGGCTGGCTCAGGACTATCTGCAGTGCG
TCCTACAGATACCACAACCTGGATCAGGTCCAAGCAAAACGTCCAGAGTGCTACAAAATG
TTGCGTTCTCAGTCCAAAAAGAAGTGGAAAAGAATCTGAAGTCATGCTTGGACAATGTTA
ATGTTGTGTCCGTAGACACTGCCAGAACACTATTCAACCAAGTGATGGAAAAGGAGTTTG
AAGACGGCATCATTAACTGGGGAAGAATTGTAACCATATTTGCATTTGAAGGTATTCTCA
TCAAGAAACTTCTACGACAGCAAATTGCCCCGGATGTGGATACCTATAAGGAGATTTCAT
ATTTTGTTGCGGAGTTCATAATGAATAACACAGGAGAATGGATAAGGCAAAACGGAGGCT
GGGGGAAATGGCACAATCACACACCTATGCTGGTAGAGTCAGTGGCCCACAAGAAGAGGA
AAATGGCTTTGTAAAGAAGTTTGAACCTAAATCTGGCTGGATGACTTTTCTAGAAGTTAC
AGGAAAGATCTGTGAAATGCTATCTCTCCTGAAGCAATACTGTTGACCAGAAAGGACACT
CCATATTGTGAAACCGGCCTAATTTTTCTGACTGATATGGAAACGATTGCCAACACATAC
TTCTACTTTTAAATAAACAACTTTGATGATGTAACTTGACCTTCCAGAGTTATGGAAATT
TTGTCCCCATGTAATGAATAAATTGTATGTATTTTTCTCTATAAAAAAAAAAAAA

Protein Sequence

>597 : length: 175
MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVN
VVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISY
FVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC