ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

596

Name

BCL2

Synonym

Bcl-2|PPP1R50;B-cell CLL/lymphoma 2;BCL2;B-cell CLL/lymphoma 2

Definition

apoptosis regulator Bcl-2|protein phosphatase 1, regulatory subunit 50

Position

18q21.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Apoptosis;Reactome;REACT:578

Pathway

transcription regulation by methyltransferase of carm1;PID BioCarta;100220

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

Ceramide signaling pathway;PID Curated;200100

Pathway

ATF-2 transcription factor network;PID Curated;200116

Pathway

telomeres telomerase cellular aging and immortality;PID BioCarta;100021

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

IL2 signaling events mediated by STAT5;PID Curated;200158

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

EPO signaling pathway;PID Curated;200157

Pathway

BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members;PID Reactome;500890

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

hiv-1 nef: negative effector of fas and tnf;PID BioCarta;100144

Pathway

stress induction of hsp regulation;PID BioCarta;100142

Pathway

Activation of BAD and translocation to mitochondria;PID Reactome;500261

Pathway

Amyotrophic lateral sclerosis (ALS);KEGG PATHWAY;hsa05014

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

Validated targets of C-MYC transcriptional repression;PID Curated;200171

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

inhibition of cellular proliferation by gleevec;PID BioCarta;100154

Pathway

p53 signaling pathway;PID BioCarta;100083

Pathway

keratinocyte differentiation;PID BioCarta;100119

Pathway

role of mitochondria in apoptotic signaling;PID BioCarta;100106

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

il-2 receptor beta chain in t cell activation;PID BioCarta;100129

Pathway

melanocyte development and pigmentation pathway;PID BioCarta;100108

Pathway

Protein processing in endoplasmic reticulum;KEGG PATHWAY;hsa04141

Pathway

apoptotic signaling in response to dna damage;PID BioCarta;100204

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

RXR and RAR heterodimerization with other nuclear receptor;PID Curated;200112

Pathway

Role of Calcineurin-dependent NFAT signaling in lymphocytes;PID Curated;200076

Pathway

Apoptosis;KEGG PATHWAY;hsa04210

Pathway

HIV-1 Nef: Negative effector of Fas and TNF-alpha;PID Curated;200133

Pathway

regulation of bad phosphorylation;PID BioCarta;100233

Pathway

il-7 signal transduction;PID BioCarta;100125

Pathway

prion pathway;PID BioCarta;100062

Pathway

Oxidative stress response;PANTHER;P00046

Pathway

IL2 signaling events mediated by PI3K;PID Curated;200099

Pathway

Caspase cascade in apoptosis;PID Curated;200148

Pathway

ceramide signaling pathway;PID BioCarta;100206

Pathway

Signaling events mediated by Stem cell factor receptor (c-Kit);PID Curated;200156

Pathway

C-MYB transcription factor network;PID Curated;200130

Disease

CANCER;GAD

Disease

Drug abuse;FunDO

Disease

Epstein-Barr virus infection;FunDO

Disease

Gastric cancer;KEGG DISEASE;H00018

Disease

Cancers of the lung and pleura;KEGG DISEASE

Disease

Oropharyngeal Neoplasms;GAD

Disease

Brain ischemia;FunDO

Disease

Asthma;FunDO

Disease

Cancer;FunDO

Disease

Carcinoma, Squamous Cell;GAD

Disease

Ischemia;FunDO

Disease

Eating disorder;FunDO

Disease

HIV infection;FunDO

Disease

Esotropia;FunDO

Disease

Keratosis;FunDO

Disease

Herpes;FunDO

Disease

Eye cancer;FunDO

Disease

lung cancer;GAD

Disease

IMMUNE;GAD

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

Disease

Thyroid gland disease;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

Kaposi's sarcoma;KEGG DISEASE;H00041

Disease

Choriocarcinoma;KEGG DISEASE;H00028

Disease

Dental plaque;FunDO

Disease

Cancers of the digestive system;KEGG DISEASE

Disease

Stroke;FunDO

Disease

Viral infections;KEGG DISEASE

Disease

Glaucoma;FunDO

Disease

Alzheimer's disease;FunDO

Disease

leukemia/lymphoma, T-Cell;GAD

Disease

Autoimmune disease;FunDO

Disease

chronic obstructive pulmonary disease/COPD lung function;GAD

Disease

Tuberculosis;FunDO

Disease

Lichen planus;FunDO

Disease

Chronic lymphocytic leukemia (CLL);KEGG DISEASE;H00005

Disease

Infections caused by dsDNA viruses;KEGG DISEASE

Disease

Cancers of the breast and female genital organs;KEGG DISEASE

Disease

Graves' disease;FunDO

Disease

Leukemia/lymphoma, B-cell, 2;OMIM

Disease

Schistosomiasis;FunDO

Disease

Hodgkin's disease;GAD

Disease

Neoplasm Recurrence, Local;GAD

Disease

Cancers;KEGG DISEASE

Disease

Lupus erythematosus;FunDO

Disease

Small cell lung cancer;KEGG DISEASE;H00013

Disease

leukemia;GAD

Disease

Cervical cancer;KEGG DISEASE;H00030

Disease

follicular lymphoma to diffuse large-cell lymphoma;GAD

Disease

Celiac disease;FunDO

Disease

Nasopharyngeal cancer;KEGG DISEASE;H00054

Disease

Congenital abnormality;FunDO

Disease

follicular lymphoma;GAD

Disease

Autistic disorder;FunDO

Disease

Head and neck cancers;KEGG DISEASE

Disease

systemic lupus erythematosus;GAD

Disease

Lupus;GAD

External Links

Links to cell senescence gene database

596

Links to epithelial mesenchymal transition gene database

596

Links to ovarian cancer gene database

596

Links to endometrial cancer gene database

596

Links to iHOP

596

Sequence Information

Nucleotide Sequence

>596 : length: 6492
TTTCTGTGAAGCAGAAGTCTGGGAATCGATCTGGAAATCCTCCTAATTTTTACTCCCTCT
CCCCGCGACTCCTGATTCATTGGGAAGTTTCAAATCAGCTATAACTGGAGAGTGCTGAAG
ATTGATGGGATCGTTGCCTTATGCATTTGTTTTGGTTTTACAAAAAGGAAACTTGACAGA
GGATCATGCTGTACTTAAAAAATACAACATCACAGAGGAAGTAGACTGATATTAACAATA
CTTACTAATAATAACGTGCCTCATGAAATAAAGATCCGAAAGGAATTGGAATAAAAATTT
CCTGCATCTCATGCCAAGGGGGAAACACCAGAATCAAGTGTTCCGCGTGATTGAAGACAC
CCCCTCGTCCAAGAATGCAAAGCACATCCAATAAAATAGCTGGATTATAACTCCTCTTCT
TTCTCTGGGGGCCGTGGGGTGGGAGCTGGGGCGAGAGGTGCCGTTGGCCCCCGTTGCTTT
TCCTCTGGGAAGGATGGCGCACGCTGGGAGAACAGGGTACGATAACCGGGAGATAGTGAT
GAAGTACATCCATTATAAGCTGTCGCAGAGGGGCTACGAGTGGGATGCGGGAGATGTGGG
CGCCGCGCCCCCGGGGGCCGCCCCCGCACCGGGCATCTTCTCCTCCCAGCCCGGGCACAC
GCCCCATCCAGCCGCATCCCGGGACCCGGTCGCCAGGACCTCGCCGCTGCAGACCCCGGC
TGCCCCCGGCGCCGCCGCGGGGCCTGCGCTCAGCCCGGTGCCACCTGTGGTCCACCTGAC
CCTCCGCCAGGCCGGCGACGACTTCTCCCGCCGCTACCGCCGCGACTTCGCCGAGATGTC
CAGCCAGCTGCACCTGACGCCCTTCACCGCGCGGGGACGCTTTGCCACGGTGGTGGAGGA
GCTCTTCAGGGACGGGGTGAACTGGGGGAGGATTGTGGCCTTCTTTGAGTTCGGTGGGGT
CATGTGTGTGGAGAGCGTCAACCGGGAGATGTCGCCCCTGGTGGACAACATCGCCCTGTG
GATGACTGAGTACCTGAACCGGCACCTGCACACCTGGATCCAGGATAACGGAGGCTGGGA
TGCCTTTGTGGAACTGTACGGCCCCAGCATGCGGCCTCTGTTTGATTTCTCCTGGCTGTC
TCTGAAGACTCTGCTCAGTTTGGCCCTGGTGGGAGCTTGCATCACCCTGGGTGCCTATCT
GGGCCACAAGTGAAGTCAACATGCCTGCCCCAAACAAATATGCAAAAGGTTCACTAAAGC
AGTAGAAATAATATGCATTGTCAGTGATGTACCATGAAACAAAGCTGCAGGCTGTTTAAG
AAAAAATAACACACATATAAACATCACACACACAGACAGACACACACACACACAACAATT
AACAGTCTTCAGGCAAAACGTCGAATCAGCTATTTACTGCCAAAGGGAAATATCATTTAT
TTTTTACATTATTAAGAAAAAAAGATTTATTTATTTAAGACAGTCCCATCAAAACTCCTG
TCTTTGGAAATCCGACCACTAATTGCCAAGCACCGCTTCGTGTGGCTCCACCTGGATGTT
CTGTGCCTGTAAACATAGATTCGCTTTCCATGTTGTTGGCCGGATCACCATCTGAAGAGC
AGACGGATGGAAAAAGGACCTGATCATTGGGGAAGCTGGCTTTCTGGCTGCTGGAGGCTG
GGGAGAAGGTGTTCATTCACTTGCATTTCTTTGCCCTGGGGGCTGTGATATTAACAGAGG
GAGGGTTCCTGTGGGGGGAAGTCCATGCCTCCCTGGCCTGAAGAAGAGACTCTTTGCATA
TGACTCACATGATGCATACCTGGTGGGAGGAAAAGAGTTGGGAACTTCAGATGGACCTAG
TACCCACTGAGATTTCCACGCCGAAGGACAGCGATGGGAAAAATGCCCTTAAATCATAGG
AAAGTATTTTTTTAAGCTACCAATTGTGCCGAGAAAAGCATTTTAGCAATTTATACAATA
TCATCCAGTACCTTAAGCCCTGATTGTGTATATTCATATATTTTGGATACGCACCCCCCA
ACTCCCAATACTGGCTCTGTCTGAGTAAGAAACAGAATCCTCTGGAACTTGAGGAAGTGA
ACATTTCGGTGACTTCCGCATCAGGAAGGCTAGAGTTACCCAGAGCATCAGGCCGCCACA
AGTGCCTGCTTTTAGGAGACCGAAGTCCGCAGAACCTGCCTGTGTCCCAGCTTGGAGGCC
TGGTCCTGGAACTGAGCCGGGGCCCTCACTGGCCTCCTCCAGGGATGATCAACAGGGCAG
TGTGGTCTCCGAATGTCTGGAAGCTGATGGAGCTCAGAATTCCACTGTCAAGAAAGAGCA
GTAGAGGGGTGTGGCTGGGCCTGTCACCCTGGGGCCCTCCAGGTAGGCCCGTTTTCACGT
GGAGCATGGGAGCCACGACCCTTCTTAAGACATGTATCACTGTAGAGGGAAGGAACAGAG
GCCCTGGGCCCTTCCTATCAGAAGGACATGGTGAAGGCTGGGAACGTGAGGAGAGGCAAT
GGCCACGGCCCATTTTGGCTGTAGCACATGGCACGTTGGCTGTGTGGCCTTGGCCCACCT
GTGAGTTTAAAGCAAGGCTTTAAATGACTTTGGAGAGGGTCACAAATCCTAAAAGAAGCA
TTGAAGTGAGGTGTCATGGATTAATTGACCCCTGTCTATGGAATTACATGTAAAACATTA
TCTTGTCACTGTAGTTTGGTTTTATTTGAAAACCTGACAAAAAAAAAGTTCCAGGTGTGG
AATATGGGGGTTATCTGTACATCCTGGGGCATTAAAAAAAAAATCAATGGTGGGGAACTA
TAAAGAAGTAACAAAAGAAGTGACATCTTCAGCAAATAAACTAGGAAATTTTTTTTTCTT
CCAGTTTAGAATCAGCCTTGAAACATTGATGGAATAACTCTGTGGCATTATTGCATTATA
TACCATTTATCTGTATTAACTTTGGAATGTACTCTGTTCAATGTTTAATGCTGTGGTTGA
TATTTCGAAAGCTGCTTTAAAAAAATACATGCATCTCAGCGTTTTTTTGTTTTTAATTGT
ATTTAGTTATGGCCTATACACTATTTGTGAGCAAAGGTGATCGTTTTCTGTTTGAGATTT
TTATCTCTTGATTCTTCAAAAGCATTCTGAGAAGGTGAGATAAGCCCTGAGTCTCAGCTA
CCTAAGAAAAACCTGGATGTCACTGGCCACTGAGGAGCTTTGTTTCAACCAAGTCATGTG
CATTTCCACGTCAACAGAATTGTTTATTGTGACAGTTATATCTGTTGTCCCTTTGACCTT
GTTTCTTGAAGGTTTCCTCGTCCCTGGGCAATTCCGCATTTAATTCATGGTATTCAGGAT
TACATGCATGTTTGGTTAAACCCATGAGATTCATTCAGTTAAAAATCCAGATGGCAAATG
ACCAGCAGATTCAAATCTATGGTGGTTTGACCTTTAGAGAGTTGCTTTACGTGGCCTGTT
TCAACACAGACCCACCCAGAGCCCTCCTGCCCTCCTTCCGCGGGGGCTTTCTCATGGCTG
TCCTTCAGGGTCTTCCTGAAATGCAGTGGTGCTTACGCTCCACCAAGAAAGCAGGAAACC
TGTGGTATGAAGCCAGACCTCCCCGGCGGGCCTCAGGGAACAGAATGATCAGACCTTTGA
ATGATTCTAATTTTTAAGCAAAATATTATTTTATGAAAGGTTTACATTGTCAAAGTGATG
AATATGGAATATCCAATCCTGTGCTGCTATCCTGCCAAAATCATTTTAATGGAGTCAGTT
TGCAGTATGCTCCACGTGGTAAGATCCTCCAAGCTGCTTTAGAAGTAACAATGAAGAACG
TGGACGTTTTTAATATAAAGCCTGTTTTGTCTTTTGTTGTTGTTCAAACGGGATTCACAG
AGTATTTGAAAAATGTATATATATTAAGAGGTCACGGGGGCTAATTGCTGGCTGGCTGCC
TTTTGCTGTGGGGTTTTGTTACCTGGTTTTAATAACAGTAAATGTGCCCAGCCTCTTGGC
CCCAGAACTGTACAGTATTGTGGCTGCACTTGCTCTAAGAGTAGTTGATGTTGCATTTTC
CTTATTGTTAAAAACATGTTAGAAGCAATGAATGTATATAAAAGCCTCAACTAGTCATTT
TTTTCTCCTCTTCTTTTTTTTCATTATATCTAATTATTTTGCAGTTGGGCAACAGAGAAC
CATCCCTATTTTGTATTGAAGAGGGATTCACATCTGCATCTTAACTGCTCTTTATGAATG
AAAAAACAGTCCTCTGTATGTACTCCTCTTTACACTGGCCAGGGTCAGAGTTAAATAGAG
TATATGCACTTTCCAAATTGGGGACAAGGGCTCTAAAAAAAGCCCCAAAAGGAGAAGAAC
ATCTGAGAACCTCCTCGGCCCTCCCAGTCCCTCGCTGCACAAATACTCCGCAAGAGAGGC
CAGAATGACAGCTGACAGGGTCTATGGCCATCGGGTCGTCTCCGAAGATTTGGCAGGGGC
AGAAAACTCTGGCAGGCTTAAGATTTGGAATAAAGTCACAGAATTAAGGAAGCACCTCAA
TTTAGTTCAAACAAGACGCCAACATTCTCTCCACAGCTCACTTACCTCTCTGTGTTCAGA
TGTGGCCTTCCATTTATATGTGATCTTTGTTTTATTAGTAAATGCTTATCATCTAAAGAT
GTAGCTCTGGCCCAGTGGGAAAAATTAGGAAGTGATTATAAATCGAGAGGAGTTATAATA
ATCAAGATTAAATGTAAATAATCAGGGCAATCCCAACACATGTCTAGCTTTCACCTCCAG
GATCTATTGAGTGAACAGAATTGCAAATAGTCTCTATTTGTAATTGAACTTATCCTAAAA
CAAATAGTTTATAAATGTGAACTTAAACTCTAATTAATTCCAACTGTACTTTTAAGGCAG
TGGCTGTTTTTAGACTTTCTTATCACTTATAGTTAGTAATGTACACCTACTCTATCAGAG
AAAAACAGGAAAGGCTCGAAATACAAGCCATTCTAAGGAAATTAGGGAGTCAGTTGAAAT
TCTATTCTGATCTTATTCTGTGGTGTCTTTTGCAGCCCAGACAAATGTGGTTACACACTT
TTTAAGAAATACAATTCTACATTGTCAAGCTTATGAAGGTTCCAATCAGATCTTTATTGT
TATTCAATTTGGATCTTTCAGGGATTTTTTTTTTAAATTATTATGGGACAAAGGACATTT
GTTGGAGGGGTGGGAGGGAGGAAGAATTTTTAAATGTAAAACATTCCCAAGTTTGGATCA
GGGAGTTGGAAGTTTTCAGAATAACCAGAACTAAGGGTATGAAGGACCTGTATTGGGGTC
GATGTGATGCCTCTGCGAAGAACCTTGTGTGACAAATGAGAAACATTTTGAAGTTTGTGG
TACGACCTTTAGATTCCAGAGACATCAGCATGGCTCAAAGTGCAGCTCCGTTTGGCAGTG
CAATGGTATAAATTTCAAGCTGGATATGTCTAATGGGTATTTAAACAATAAATGTGCAGT
TTTAACTAACAGGATATTTAATGACAACCTTCTGGTTGGTAGGGACATCTGTTTCTAAAT
GTTTATTATGTACAATACAGAAAAAAATTTTATAAAATTAAGCAATGTGAAACTGAATTG
GAGAGTGATAATACAAGTCCTTTAGTCTTACCCAGTGAATCATTCTGTTCCATGTCTTTG
GACAACCATGACCTTGGACAATCATGAAATATGCATCTCACTGGATGCAAAGAAAATCAG
ATGGAGCATGAATGGTACTGTACCGGTTCATCTGGACTGCCCCAGAAAAATAACTTCAAG
CAAACATCCTATCAACAACAAGGTTGTTCTGCATACCAAGCTGAGCACAGAAGATGGGAA
CACTGGTGGAGGATGGAAAGGCTCGCTCAATCAAGAAAATTCTGAGACTATTAATAAATA
AGACTGTAGTGTAGATACTGAGTAAATCCATGCACCTAAACCTTTTGGAAAATCTGCCGT
GGGCCCTCCAGATAGCTCATTTCATTAAGTTTTTCCCTCCAAGGTAGAATTTGCAAGAGT
GACAGTGGATTGCATTTCTTTTGGGGAAGCTTTCTTTTGGTGGTTTTGTTTATTATACCT
TCTTAAGTTTTCAACCAAGGTTTGCTTTTGTTTTGAGTTACTGGGGTTATTTTTGTTTTA
AATAAAAATAAGTGTACAATAAGTGTTTTTGTATTGAAAGCTTTTGTTATCAAGATTTTC
ATACTTTTACCTTCCATGGCTCTTTTTAAGATTGATACTTTTAAGAGGTGGCTGATATTC
TGCAACACTGTACACATAAAAAATACGGTAAGGATACTTTACATGGTTAAGGTAAAGTAA
GTCTCCAGTTGGCCACCATTAGCTATAATGGCACTTTGTTTGTGTTGTTGGAAAAAGTCA
CATTGCCATTAAACTTTCCTTGTCTGTCTAGTTAATATTGTGAAGAAAAATAAAGTACAG
TGTGAGATACTG

Protein Sequence

>596 : length: 239
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK