ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

595

Name

CCND1

Synonym

BCL1|D11S287E|PRAD1|U21B31;cyclin D1;CCND1;cyclin D1

Definition

B-cell CLL/lymphoma 1|B-cell lymphoma 1 protein|BCL-1 oncogene|G1/S-specific cyclin-D1|PRAD1 oncogene

Position

11q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054

Pathway

il-2 receptor beta chain in t cell activation;PID BioCarta;100129

Pathway

Presenilin action in Notch and Wnt signaling;PID Curated;200052

Pathway

Cyclin D associated events in G1;PID Reactome;500897

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

ATF-2 transcription factor network;PID Curated;200116

Pathway

cell cycle: g1/s check point;PID BioCarta;100160

Pathway

FOXM1 transcription factor network;PID Curated;200120

Pathway

btg family proteins and cell cycle regulation;PID BioCarta;100224

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Trk receptor signaling mediated by PI3K and PLC-gamma;PID Curated;200183

Pathway

inactivation of gsk3 by akt causes accumulation of b-catenin in alveolar macrophages;PID BioCarta;100152

Pathway

Regulation of Telomerase;PID Curated;200072

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

Neurotrophic factor-mediated Trk receptor signaling;PID Curated;200128

Pathway

Bladder cancer;KEGG PATHWAY;hsa05219

Pathway

Validated targets of C-MYC transcriptional repression;PID Curated;200171

Pathway

PI3 kinase pathway;PANTHER;P00048

Pathway

Signaling events mediated by focal adhesion kinase;PID Curated;200192

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

Thyroid cancer;KEGG PATHWAY;hsa05216

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

wnt signaling pathway;PID BioCarta;100002

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

p53 signaling pathway;PID BioCarta;100083

Pathway

Notch signaling pathway;PID Curated;200013

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044

Pathway

Non-small cell lung cancer;KEGG PATHWAY;hsa05223

Pathway

E-cadherin signaling in the nascent adherens junction;PID Curated;200105

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Cell cycle;PANTHER;P00013

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

cyclins and cell cycle regulation;PID BioCarta;100207

Pathway

Viral myocarditis;KEGG PATHWAY;hsa05416

Pathway

Ubiquitin-dependent degradation of Cyclin D1;PID Reactome;501007

Pathway

Signaling mediated by p38-gamma and p38-delta;PID Curated;200143

Pathway

p53 signaling pathway;KEGG PATHWAY;hsa04115

Pathway

Coregulation of Androgen receptor activity;PID Curated;200038

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

breast cancer;GAD

Disease

Osteitis deformans;FunDO

Disease

kidney cancer;GAD

Disease

squamous cell carcinoma;GAD

Disease

cardiac cancer;GAD

Disease

laryngeal squamous cell carcinoma;GAD

Disease

Cancer;FunDO

Disease

Oral cancer;FunDO

Disease

bladder cancer;GAD

Disease

esophageal cancer;GAD

Disease

tumour grade;GAD

Disease

Neck cancer;FunDO

Disease

Keratosis;FunDO

Disease

oral cancer;GAD

Disease

Multiple myeloma;KEGG DISEASE;H00010

Disease

pituitary cancer;GAD

Disease

cervical cancer;GAD

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

Disease

Endemic goiter;FunDO

Disease

Colorectal cancer, susceptibility to;OMIM

Disease

prostate cancer;GAD

Disease

PHARMACOGENOMIC;GAD

Disease

Cancers of the digestive system;KEGG DISEASE

Disease

Neoplasms;GAD

Disease

benzene toxicity;GAD

Disease

Hyperparathyroidism;FunDO

Disease

colorectal cancer;GAD

Disease

Drug abuse;FunDO

Disease

Breast cancer;KEGG DISEASE;H00031

Disease

Hairy-cell leukemia;KEGG DISEASE;H00006

Disease

Hamman-Rich syndrome;FunDO

Disease

gastroesophageal cancer;GAD

Disease

prostatic hyperplasia;GAD

Disease

Adenovirus infection;FunDO

Disease

CANCER;GAD

Disease

Oral cancer;KEGG DISEASE;H00016

Disease

Kidney failure;FunDO

Disease

squamous cell carcinoma of the head and neck;GAD

Disease

Laryngeal cancer;KEGG DISEASE;H00055

Disease

Cancers of the breast and female genital organs;KEGG DISEASE

Disease

Endometriosis;FunDO

Disease

ER negative;GAD

Disease

colorectal cancer, nonpolyposis;GAD

Disease

Stomach Neoplasms;GAD

Disease

urinary bladder cancer;GAD

Disease

Cancers;KEGG DISEASE

Disease

lung cancer smoking behavior;GAD

Disease

bladder cancer, urinary;GAD

Disease

gastric cardiac cancer;GAD

Disease

liver cancer;GAD

Disease

lymphocytic lymphoma of intermediate differentiation;GAD

Disease

stomach cancer;GAD

Disease

Obesity;FunDO

Disease

Congenital abnormality;FunDO

Disease

von Hippel-Lindau disease, modification of;OMIM

Disease

endometrial cancer;GAD

Disease

Head and neck cancers;KEGG DISEASE

Disease

advanced colorectal cancer;GAD

Disease

Esophageal cancer;KEGG DISEASE;H00017

External Links

Links to cell senescence gene database

595

Links to epithelial mesenchymal transition gene database

595

Links to ovarian cancer gene database

595

Links to endometrial cancer gene database

595

Links to iHOP

595

Sequence Information

Nucleotide Sequence

>595 : length: 4304
CACACGGACTACAGGGGAGTTTTGTTGAAGTTGCAAAGTCCTGGAGCCTCCAGAGGGCTG
TCGGCGCAGTAGCAGCGAGCAGCAGAGTCCGCACGCTCCGGCGAGGGGCAGAAGAGCGCG
AGGGAGCGCGGGGCAGCAGAAGCGAGAGCCGAGCGCGGACCCAGCCAGGACCCACAGCCC
TCCCCAGCTGCCCAGGAAGAGCCCCAGCCATGGAACACCAGCTCCTGTGCTGCGAAGTGG
AAACCATCCGCCGCGCGTACCCCGATGCCAACCTCCTCAACGACCGGGTGCTGCGGGCCA
TGCTGAAGGCGGAGGAGACCTGCGCGCCCTCGGTGTCCTACTTCAAATGTGTGCAGAAGG
AGGTCCTGCCGTCCATGCGGAAGATCGTCGCCACCTGGATGCTGGAGGTCTGCGAGGAAC
AGAAGTGCGAGGAGGAGGTCTTCCCGCTGGCCATGAACTACCTGGACCGCTTCCTGTCGC
TGGAGCCCGTGAAAAAGAGCCGCCTGCAGCTGCTGGGGGCCACTTGCATGTTCGTGGCCT
CTAAGATGAAGGAGACCATCCCCCTGACGGCCGAGAAGCTGTGCATCTACACCGACAACT
CCATCCGGCCCGAGGAGCTGCTGCAAATGGAGCTGCTCCTGGTGAACAAGCTCAAGTGGA
ACCTGGCCGCAATGACCCCGCACGATTTCATTGAACACTTCCTCTCCAAAATGCCAGAGG
CGGAGGAGAACAAACAGATCATCCGCAAACACGCGCAGACCTTCGTTGCCCTCTGTGCCA
CAGATGTGAAGTTCATTTCCAATCCGCCCTCCATGGTGGCAGCGGGGAGCGTGGTGGCCG
CAGTGCAAGGCCTGAACCTGAGGAGCCCCAACAACTTCCTGTCCTACTACCGCCTCACAC
GCTTCCTCTCCAGAGTGATCAAGTGTGACCCGGACTGCCTCCGGGCCTGCCAGGAGCAGA
TCGAAGCCCTGCTGGAGTCAAGCCTGCGCCAGGCCCAGCAGAACATGGACCCCAAGGCCG
CCGAGGAGGAGGAAGAGGAGGAGGAGGAGGTGGACCTGGCTTGCACACCCACCGACGTGC
GGGACGTGGACATCTGAGGGCGCCAGGCAGGCGGGCGCCACCGCCACCCGCAGCGAGGGC
GGAGCCGGCCCCAGGTGCTCCCCTGACAGTCCCTCCTCTCCGGAGCATTTTGATACCAGA
AGGGAAAGCTTCATTCTCCTTGTTGTTGGTTGTTTTTTCCTTTGCTCTTTCCCCCTTCCA
TCTCTGACTTAAGCAAAAGAAAAAGATTACCCAAAAACTGTCTTTAAAAGAGAGAGAGAG
AAAAAAAAAATAGTATTTGCATAACCCTGAGCGGTGGGGGAGGAGGGTTGTGCTACAGAT
GATAGAGGATTTTATACCCCAATAATCAACTCGTTTTTATATTAATGTACTTGTTTCTCT
GTTGTAAGAATAGGCATTAACACAAAGGAGGCGTCTCGGGAGAGGATTAGGTTCCATCCT
TTACGTGTTTAAAAAAAAGCATAAAAACATTTTAAAAACATAGAAAAATTCAGCAAACCA
TTTTTAAAGTAGAAGAGGGTTTTAGGTAGAAAAACATATTCTTGTGCTTTTCCTGATAAA
GCACAGCTGTAGTGGGGTTCTAGGCATCTCTGTACTTTGCTTGCTCATATGCATGTAGTC
ACTTTATAAGTCATTGTATGTTATTATATTCCGTAGGTAGATGTGTAACCTCTTCACCTT
ATTCATGGCTGAAGTCACCTCTTGGTTACAGTAGCGTAGCGTGCCCGTGTGCATGTCCTT
TGCGCCTGTGACCACCACCCCAACAAACCATCCAGTGACAAACCATCCAGTGGAGGTTTG
TCGGGCACCAGCCAGCGTAGCAGGGTCGGGAAAGGCCACCTGTCCCACTCCTACGATACG
CTACTATAAAGAGAAGACGAAATAGTGACATAATATATTCTATTTTTATACTCTTCCTAT
TTTTGTAGTGACCTGTTTATGAGATGCTGGTTTTCTACCCAACGGCCCTGCAGCCAGCTC
ACGTCCAGGTTCAACCCACAGCTACTTGGTTTGTGTTCTTCTTCATATTCTAAAACCATT
CCATTTCCAAGCACTTTCAGTCCAATAGGTGTAGGAAATAGCGCTGTTTTTGTTGTGTGT
GCAGGGAGGGCAGTTTTCTAATGGAATGGTTTGGGAATATCCATGTACTTGTTTGCAAGC
AGGACTTTGAGGCAAGTGTGGGCCACTGTGGTGGCAGTGGAGGTGGGGTGTTTGGGAGGC
TGCGTGCCAGTCAAGAAGAAAAAGGTTTGCATTCTCACATTGCCAGGATGATAAGTTCCT
TTCCTTTTCTTTAAAGAAGTTGAAGTTTAGGAATCCTTTGGTGCCAACTGGTGTTTGAAA
GTAGGGACCTCAGAGGTTTACCTAGAGAACAGGTGGTTTTTAAGGGTTATCTTAGATGTT
TCACACCGGAAGGTTTTTAAACACTAAAATATATAATTTATAGTTAAGGCTAAAAAGTAT
ATTTATTGCAGAGGATGTTCATAAGGCCAGTATGATTTATAAATGCAATCTCCCCTTGAT
TTAAACACACAGATACACACACACACACACACACACACAAACCTTCTGCCTTTGATGTTA
CAGATTTAATACAGTTTATTTTTAAAGATAGATCCTTTTATAGGTGAGAAAAAAACAATC
TGGAAGAAAAAAACCACACAAAGACATTGATTCAGCCTGTTTGGCGTTTCCCAGAGTCAT
CTGATTGGACAGGCATGGGTGCAAGGAAAATTAGGGTACTCAACCTAAGTTCGGTTCCGA
TGAATTCTTATCCCCTGCCCCTTCCTTTAAAAAACTTAGTGACAAAATAGACAATTTGCA
CATCTTGGCTATGTAATTCTTGTAATTTTTATTTAGGAAGTGTTGAAGGGAGGTGGCAAG
AGTGTGGAGGCTGACGTGTGAGGGAGGACAGGCGGGAGGAGGTGTGAGGAGGAGGCTCCC
GAGGGGAAGGGGCGGTGCCCACACCGGGGACAGGCCGCAGCTCCATTTTCTTATTGCGCT
GCTACCGTTGACTTCCAGGCACGGTTTGGAAATATTCACATCGCTTCTGTGTATCTCTTT
CACATTGTTTGCTGCTATTGGAGGATCAGTTTTTTGTTTTACAATGTCATATACTGCCAT
GTACTAGTTTTAGTTTTCTCTTAGAACATTGTATTACAGATGCCTTTTTTGTAGTTTTTT
TTTTTTTTATGTGATCAATTTTGACTTAATGTGATTACTGCTCTATTCCAAAAAGGTTGC
TGTTTCACAATACCTCATGCTTCACTTAGCCATGGTGGACCCAGCGGGCAGGTTCTGCCT
GCTTTGGCGGGCAGACACGCGGGCGCGATCCCACACAGGCTGGCGGGGGCCGGCCCCGAG
GCCGCGTGCGTGAGAACCGCGCCGGTGTCCCCAGAGACCAGGCTGTGTCCCTCTTCTCTT
CCCTGCGCCTGTGATGCTGGGCACTTCATCTGATCGGGGGCGTAGCATCATAGTAGTTTT
TACAGCTGTGTTATTCTTTGCGTGTAGCTATGGAAGTTGCATAATTATTATTATTATTAT
TATAACAAGTGTGTCTTACGTGCCACCACGGCGTTGTACCTGTAGGACTCTCATTCGGGA
TGATTGGAATAGCTTCTGGAATTTGTTCAAGTTTTGGGTATGTTTAATCTGTTATGTACT
AGTGTTCTGTTTGTTATTGTTTTGTTAATTACACCATAATGCTAATTTAAAGAGACTCCA
AATCTCAATGAAGCCAGCTCACAGTGCTGTGTGCCCCGGTCACCTAGCAAGCTGCCGAAC
CAAAAGAATTTGCACCCCGCTGCGGGCCCACGTGGTTGGGGCCCTGCCCTGGCAGGGTCA
TCCTGTGCTCGGAGGCCATCTCGGGCACAGGCCCACCCCGCCCCACCCCTCCAGAACACG
GCTCACGCTTACCTCAACCATCCTGGCTGCGGCGTCTGTCTGAACCACGCGGGGGCCTTG
AGGGACGCTTTGTCTGTCGTGATGGGGCAAGGGCACAAGTCCTGGATGTTGTGTGTATCG
AGAGGCCAAAGGCTGGTGGCAAGTGCACGGGGCACAGCGGAGTCTGTCCTGTGACGCGCA
AGTCTGAGGGTCTGGGCGGCGGGCGGCTGGGTCTGTGCATTTCTGGTTGCACCGCGGCGC
TTCCCAGCACCAACATGTAACCGGCATGTTTCCAGCAGAAGACAAAAAGACAAACATGAA
AGTCTAGAAATAAAACTGGTAAAACCCCAAAAAAAAAAAAAAAA

Protein Sequence

>595 : length: 303
MGSFGGTPLGKGGPLFKQRVPGRPERAAWAGEHGELQGRVAPKTPGLDPRLQGYRLGGPS
PSEPGAWEHIFRPSVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASK
MKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAE
ENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRF
LSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRD
VDI