ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5940

Name

RBMY1A1

Synonym

RBM|RBM1|RBM2|RBMY|RBMY1C|YRRM1|YRRM2;RNA binding motif protein, Y-linked, family 1, member A1;RBMY1A1;RNA binding motif protein, Y-linked, family 1, member A1

Definition

RNA binding motif protein, Y chromosome, family 1, member A1|RNA binding protein|RNA-binding motif protein 1|RNA-binding motif protein 2|RNA-binding motif protein, Y chromosome, family 1 member A1|RNA-binding motif protein, Y chromosome, family 1 member A

Position

Yq11.223

Gene Type

protein-coding

External Links

Links to cell senescence gene database

5940

Links to epithelial mesenchymal transition gene database

5940

Links to ovarian cancer gene database

5940

Links to endometrial cancer gene database

5940

Links to iHOP

5940

Sequence Information

Nucleotide Sequence

>5940 : length: 2710
AGTTGGCCCTGTGGTGTTCCGAAGCCGGTTACGTACGGCCTGAGGGCCAGGCGAACCTCA
GGCTCTTTGTCCTACTAAAAAGCGCAGCACAATGGTAGAAGCAGATCATCCTGGCAAGCT
TTTCATTGGTGGCCTCAATAGAGAAACCAATGAGAAGATGCTTAAAGCAGTATTTGGGAA
ACATGGTCCCATATCAGAAGTTCTTTTGATAAAGGATCGAACCAGCAAATCCAGAGGCTT
TGCATTTATTACTTTTGAGAACCCTGCAGATGCTAAGAATGCTGCCAAAGATATGAATGG
AAAGTCTTTGCATGGAAAAGCAATAAAAGTAGAACAAGCCAAGAAACCATCTTTTCAAAG
TGGTGGTAGGCGGAGACCACCAGCTTCTTCGAGAAACAGAAGCCCTTCAGGAAGTCTGAG
ATCTGCAAGAGGAAGCCGTGGAGGAACAAGAGGGTGGCTTCCCTCACATGAAGGGCACCT
GGATGATGGTGGATACACTCCTGATCTCAAGATGAGTTATTCTAGGGGACTCATTCCAGT
TAAAAGAGGTCCATCTTCAAGAAGTGGAGGTCCTCCTCCGAAAAAATCTGCTCCTTCTGC
TGTGGCAAGAAGCAATAGTTGGATGGGAAGCCAAGGTCCCATGTCACAAAGAAGAGAGAA
TTATGGAGTTCCTCCACGCAGAGCGACAATATCTTCCTGGAGAAATGATCGCATGTCAAC
AAGACATGATGGTTATGCAACTAACGATGGAAATCATCCAAGTTGCCAAGAAACGAGGGA
TTATGCTCCACCATCTAGAGGCTATGCATACCGTGATAATGGTCATTCTAATCGGGATGA
ACATTCCTCTAGAGGATATAGAAATCATCGAAGTTCCCGAGAAACTAGGGATTATGCTCC
ACCATCTAGAGGCCATGCATACCGTGATTATGGTCATTCTCGTCGGGATGAAAGTTATTC
TAGAGGATACAGAAATCGTCGAAGTTCCCGAGAAACTAGGGAGTATGCTCCACCATCTAG
AGGCCATGGATACCGTGATTATGGTCATTCTCGTCGACATGAAAGTTATTCTAGAGGATA
TAGAAATCATCCAAGTTCCCGAGAAACCAGGGATTATGCTCCACCACATAGAGACTATGC
ATACCGTGATTATGGTCATTCTAGTTGGGATGAACATTCCTCTAGAGGATATAGTTATCA
TGATGGCTACGGTGAGGCCCTTGGTAGAGATCATTCTGAACATCTAAGTGGAAGTTCTTA
TAGAGATGCACTTCAGAGATACGCAACCTTATTTCAGAAAACGGTGCATATTACTGCAGA
AATCACATGGACAGGTCCAAAGCGGGGAGGAGGAGGATGAGGAGGAAGAGGAGGAGGAGG
AGGTGAAGAAGAAGAAGAAGAGGAAGAAGAAGTAGAAGAAGAAGGAGGAGGAGGAGGAAG
CGGCAAGCTTTTAAGTCTATACATTAGTATCACTGTGTCAGAAACTCAGTAGTCATAGTG
AAATAAAAACAATGATCACAGTCAGTCAATTCCATCTCATACCTAGACTGAAATATGAAA
CTTCTAAAGAAAAGAAAGTTAAGAACTTTGGGCATATCAAAATGTTCCTATACAGATAAA
ATTATTGGTGACTTTTTCTCACTAGAAAACATACAATTCCATGCTTTGTATATGTGTAAA
TAAAAATATTTTTATTTCCATCAGTTATGATGTGCAAGCAAGTAATAAAGTGAAAGTACA
CTAATAAAATGATATAAGGAAATTTCTCTGTGTCAAAAAATTCCATTGAGGCCATTAATT
TTACAAAAACCACGGAGAATGCATGGTGAAACTACACTATACAGTACTTTTTAGTATTTT
ACTTGCATTTTAAATAATCAACAAAGGAAAGGAAATTCTTAATCATTATTTATTACCAAT
AACATTATTCTACTCGAATAATCCTTTTGAGATTAAGTATTTTAAATAAAACTTTAAAAA
CAAATTGTATTGACTGATACCAGCTTTCAATGAAATAACACTTCTGTATTTGTAGTCATG
TGAAGTATAAATTTCTCCTCACAGTGGATCTTTTATAACACCAGTTTTATTGATTTCTCT
GATAGAAACCCTGTGATAGCTCATGCATGGCTTTACTGTAACCATACATTACATGACTCC
AGAGAGTAGCCTTCAAATAGATGGAAAAATTATATTTGTGACAAAATTCTAAGAAAGGGA
ATGGTAAAATGGGAGAATAATTTCTAAATTTCTAACTGTTCATCAGTGGATTTGGATATA
TTTAGATATAGACAAATATTAGCACACTGCAAGTTTGCACATGTGTATATAAATTTATAT
GAGATACCCATAATGTGTGGGTTGTGTAATATTTTAATCCTCAATTTTACATGTGGGAAA
TTTGGTAAGAGTTTATCTTTATCAAATAATCAATTTGAAGTACTATACTCAATTTGATGT
AAAACCAACAAAATCTCTGTCAACATTCACTTTAATTGATCCAATAATGTTAACTGATGA
TAACTTCATTCTCTTTGTCCCCTGTTGGCAGCCTGAAAGTTGATTCTCACTCTAATTCAT
CACTCAAGGTGCCATCCACAAGACACTAACTTTGCTGTGGATTGTGACTTCTCACGCCAA
CACTTTTTTCCTGTAACAGTCCTACCTTTGTATATTTAAAGAATTTGTACATGGCTAAAA
AAAAATAAAA

Protein Sequence

>5940 : length: 496
MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPAD
AKNAAKDMNGKSLHGKAIKVEQAKKPSFQSGGRRRPPASSRNRSPSGSLRSARGSRGGTR
GWLPSHEGHLDDGGYTPDLKMSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGS
QGPMSQRRENYGVPPRRATISSWRNDRMSTRHDGYATNDGNHPSCQETRDYAPPSRGYAY
RDNGHSNRDEHSSRGYRNHRSSRETRDYAPPSRGHAYRDYGHSRRDESYSRGYRNRRSSR
ETREYAPPSRGHGYRDYGHSRRHESYSRGYRNHPSSRETRDYAPPHRDYAYRDYGHSSWD
EHSSRGYSYHDGYGEALGRDHSEHLSGSSYRDALQRYGTSHGAPPARGPRMSYGGSTCHA
YSNTRDRYGRSWESYSSCGDFHYCDREHVCRKDQRNPPSLGRVLPDPREACGSSSYVASI
VDGGESRSEKGDSSRY