ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

59336

Name

PRDM13

Synonym

MU-MB-20.220|PFM10;PR domain containing 13;PRDM13;PR domain containing 13

Definition

PR domain zinc finger protein 13|PR domain-containing protein 13|PR-domain containing protein 13|PR-domain zinc finger protein 13

Position

6q16.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

59336

Links to epithelial mesenchymal transition gene database

59336

Links to ovarian cancer gene database

59336

Links to endometrial cancer gene database

59336

Links to iHOP

59336

Sequence Information

Nucleotide Sequence

>59336 : length: 3204
CCATGTGACCCTCTCGGGTGGGACTCTGCAGCTGCTTCGCAGCGCAACTCTCTCACCAAA
CTCCGCGCCCTTGCGCTAGCGGTGCCAAAAGGCTCCCGCCCCGATTGAAAAGGCGCAGTG
CATGCCCGCCCGCGTCACTCCGCGGGCGGAGGACGCACGTCGGGGCGCGGCTCTCTGGCT
AGCGCGCAGCTCCAGCTCTGTCACTCGCGCCCTTCCAAGGACCTGGAGCACCCGAGCGCC
TGCCTGGTGGCGGCGGCAACAATGCACGGAGCCGCCAGAGCGCCAGCCACCAGCGTGAGT
GCCGACTGCTGCATCCCGGCCGGCTTGCGCCTCGGACCGGTGCCTGGTACCTTCAAGCTG
GGCAAGTACCTGTCAGACCGCAGGGAGCCCGGGCCTAAGAAAAAGGTGCGCATGGTGAGA
GGGGAGCTGGTGGACGAGTCGGGGGGCTCCCCTCTGGAGTGGATAGGGTTAATCCGGGCA
GCCAGAAACTCCCAGGAACAGACTCTGGAAGCTATTGCAGACTTACCCGGAGGACAGATC
TTCTACCGAGCATTGCGAGACGTCCAGCCAGGGGAGGAGCTGACAGTGTGGTATTCTAAC
TCCTTGGCTCAGTGGTTCGACATCCCCACCACAGCGACTCCGACTCACGACGAGAAAGGG
GAGGAGCGCTACATCTGCTGGTACTGCTGGAGGACGTTTAGATACCCCAACAGCCTTAAG
GCACACCTGCGTTTCCACTGCGTGTTCAGCGGCGGTGGAGGCGGCGCCTTCCTGCACCAC
GAACACGCGGCTCGCCAAGGCGCCGTCCCAGCGGCTGATGGCCTCGGTCTCTCCCCAAAA
CCCCCGGCGCCCGATTTCGCCGCGCCTTCCCAGGCAGGAACTTTGCGACCCCACCCCCTG
GGCCCGCCACCAGTTCAGGCCTGCGGTGCGCGGGAGGGCATCAAGCGCGAGGCCTCTTCC
GCGCCCTCGGCCACCTCGCCGACCCCAGGCAAGTGGGGGCAGCCCAAGAAGGGCAAGGAG
CAGCTGGACCGTGCCCTGGACATGAGCGGAGCCGCCCGAGGACAAGGGCACTTCCTCGGC
ATCGTGGGCGGCTCCTCGGCGGGGGTCGGCAGCCTGGCTTTCTACCCCGGCGTGCGCTCA
GCTTTCAAGCCCGCCGGCCTAGCGAGGGCGGCGGCGGCCGCTCACGGCGACCCCTACCGG
GAGGAGAGCAGCAGCAAGCAAGGAGCCGGCCTCGCTTTGGGCAGGCTGCTGGGCGGGGGC
CGGGCGTGCGGGCGCCCCGGGAGCGGGGAGAACTCGGCGGCGGGCGGCGCGGGTCACCAC
CATCACCACCACGCGCACCACCACCACCATCCCAAGTGCCTGCTCGCTGGGGACCCGCCG
CCGCCGCCGCCGCCTGGCCTGCCCTGCTCTGGGGCCCTGCGCGGCTTCCCTCTGCTCTCC
GTCCCCCCGGAAGAGGCGTCCGCCTTCAAGCACGTGGAGCGCGCCCCGCCCGCAGCCGCC
GCGCTGCCAGGAGCGCGTTATGCGCAGCTGCCCCCTGCGCCGGGGTTGCCCCTCGAGCGC
TGCGCGCTGCCGCCCCTCGACCCGGGCGGTCTCAAAGCCTATCCGGGTGGTGAGTGCAGC
CACCTGCCCGCCGTCATGCCGGCCTTTACAGTCTACAACGGGGAGCTGCTCTACGGCTCA
CCGGCCACCACCGCTTATTACCCGCTCAAATTGCACTTCGGCGGGCTGCTGAAGTATCCG
GAGTCCATCTCCTACTTCAGCGGGCCTGCAGCGGCCGCCCTAAGCCCCGCCGAGCTGGGG
TCGCTGGCCAGCATCGACCGAGAGATCGCCATGCACAATCAGCAGCTGTCCGAGATGGCT
GCCGGGAAGGGTCGCGGACGCCTGGACTCGGGGACGTTGCCACCGGCCGTCGCGGCGGCG
GGAGGCACCGGGGGCGGCGGCAGCGGAGGCAGCGGCGCAGGTAAGCCCAAGACCGGCCAC
CTGTGCCTCTACTGTGGCAAGCTGTACTCGCGCAAGTATGGGCTCAAGATCCACATGCGG
ACGCACACGGGCTACAAGCCACTCAAGTGCAAAGTCTGTCTGCGGCCCTTCGGCGACCCC
AGCAATCTCAACAAGCACATCCGGCTGCACGCCGAGGGCAATACGCCCTACCGCTGCGAG
TTCTGCGGCAAGGTACTTGTGCGCCGCCGGGACCTGGAGCGACATGTCAAGTCCCGCCAC
CCTGGCCAGAGTCTGCTCGCCAAAGCGGGCGACGGCCCGGGTGCCGAGCCCGGCTATCCC
CCGGAGCCTGGGGATCCCAAGAGCGACGACAGTGACGTGGACGTCTGCTTCACAGACGAC
CAGAGCGACCCCGAGGTTGGGGGCGGCGGGGAGCGCGACTTGTAACGAGTCTTCCCGGGA
AGGGGCGGGGTGAGGACAGAGAGGAGTCGAGGGTTTATTCTCGCAGTAGAGGAACTCCTG
GTGGTGGGAAGAGGGACCCAATGGACAAAACCGTTTTTGTTTTTGAGAGGGCGCCAGATT
TGAAACAGTGAGAGGTCCCACATCTGGTGCTGAAACTCAGAGCAACAGTTCAGAGGTGGC
GTAAATCTGGCCACCTGGAGAGCTCGAGTGCCACCAGTACCTCCGCACCCCGGGCCTCTG
GACTTCTTGGATGAGCTCACCCTGAACCGCCCAGGCGGTCTGCTCTTGGTGTTCAGAATC
ACATCAATGCGAACGTCACAGCGCCTTCGAGGGCGCAGATTTTAACTGCCACGTATTTTT
AAGTTGTACTTTTCTGTGGAGGAAATTGTGCCTTTTGAAACGACGTTTTGTGTGTGTATT
TCACGTTAGCATTTCATTGCATAGGCAAAACACTAGTCACAATTGGGTAGATGTGACATC
CATATACTTGTTTACATTTTATCTGTTCTCATGTCAAAGACTACTCCTTGCCCCATTGAA
TATATAGTGGTAGCAGGTGTACAAATTGGTCAAGTTGCAATTATTTATGAGAAAATAATG
ATAAATGTAAAATATCTAAAGCATGAATCTAAGAGCACGCAATATATAATTTTAAAGAAA
ATATTCTATTTGGTAGAATACAAATGTGGTGTGTGTTGTTTTATAATGACTGCTGTACAG
TGGGTATAGTATTTTGGTTTTGGTTCCAGATTGTGCAATCTTTAAGAAAAATAAAGATAC
AAACGAGAGTTTTGTTCACTTAGT

Protein Sequence

>59336 : length: 707
MHGAARAPATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVRMVRGELVDES
GGSPLEWIGLIRAARNSQEQTLEAIADLPGGQIFYRALRDVQPGEELTVWYSNSLAQWFD
IPTTATPTHDEKGEERYICWYCWRTFRYPNSLKAHLRFHCVFSGGGGGAFLHHEHAARQG
AVPAADGLGLSPKPPAPDFAAPSQAGTLRPHPLGPPPVQACGAREGIKREASSAPSATSP
TPGKWGQPKKGKEQLDRALDMSGAARGQGHFLGIVGGSSAGVGSLAFYPGVRSAFKPAGL
ARAAAAAHGDPYREESSSKQGAGLALGRLLGGGRACGRPGSGENSAAGGAGHHHHHHAHH
HHHPKCLLAGDPPPPPPPGLPCSGALRGFPLLSVPPEEASAFKHVERAPPAAAALPGARY
AQLPPAPGLPLERCALPPLDPGGLKAYPGGECSHLPAVMPAFTVYNGELLYGSPATTAYY
PLKLHFGGLLKYPESISYFSGPAAAALSPAELGSLASIDREIAMHNQQLSEMAAGKGRGR
LDSGTLPPAVAAAGGTGGGGSGGSGAGKPKTGHLCLYCGKLYSRKYGLKIHMRTHTGYKP
LKCKVCLRPFGDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLERHVKSRHPGQSLLA
KAGDGPGAEPGYPPEPGDPKSDDSDVDVCFTDDQSDPEVGGGGERDL