ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

59335

Name

PRDM12

Synonym

PFM9;PR domain containing 12;PRDM12;PR domain containing 12

Definition

PR domain zinc finger protein 12|PR domain-containing protein 12|PR-domain containing protein 12|PR-domain zinc finger protein 12

Position

9q34.12

Gene Type

protein-coding

External Links

Links to cell senescence gene database

59335

Links to epithelial mesenchymal transition gene database

59335

Links to ovarian cancer gene database

59335

Links to endometrial cancer gene database

59335

Links to iHOP

59335

Sequence Information

Nucleotide Sequence

>59335 : length: 2492
CCCGCCCACCTCCCCCGTCGGCCCGGCCGTCCCCCGGCGCCGGGGAGCTCCGGGCCGCCC
ATGATGGGCTCCGTGCTCCCGGCTGAGGCCCTGGTGCTCAAGACCGGGCTGAAGGCGCCG
GGACTGGCGCTGGCCGAGGTTATCACCTCCGACATCCTGCACAGCTTCCTGTACGGCCGC
TGGCGCAACGTGCTCGGGGAGCAGCTCTTCGAGGACAAGAGCCACCACGCCAGCCCCAAG
ACAGCCTTCACCGCCGAGGTGCTGGCGCAGTCCTTCTCCGGCGAAGTGCAGAAGCTGTCC
AGCCTGGTGCTGCCTGCGGAGGTGATCATCGCTCAGAGCTCCATCCCTGGCGAGGGCCTC
GGCATCTTCTCCAAGACGTGGATCAAGGCGGGAACCGAGATGGGCCCCTTCACCGGCCGC
GTGATCGCCCCGGAGCACGTGGACATCTGCAAGAACAACAACCTCATGTGGGAGGTGTTC
AATGAGGATGGCACGGTGCGCTACTTCATCGATGCCAGCCAGGAGGACCACCGGAGCTGG
ATGACCTACATCAAGTGTGCACGTAACGAACAGGAGCAGAACCTGGAGGTGGTCCAGATC
GGCACCAGCATCTTCTACAAGGCCATTGAGATGATCCCACCTGACCAGGAACTGCTGGTG
TGGTACGGAAACTCACACAACACCTTCCTGGGGATCCCAGGTGTGCCCGGGCTAGAGGAG
GACCAGAAAAAGAACAAGCATGAGGACTTCCACCCGGCGGACTCGGCGGCTGGCCCCGCG
GGCCGCATGCGATGCGTCATCTGCCACCGCGGCTTCAACTCGCGCAGCAACCTGCGCTCG
CACATGCGCATCCACACGCTGGACAAGCCCTTCGTGTGCCGCTTCTGCAACCGCCGCTTC
AGCCAGTCGTCCACGCTGCGCAACCACGTGCGCCTGCACACGGGCGAGCGCCCCTACAAG
TGCCAGGTGTGCCAGAGCGCCTACTCGCAGCTGGCCGGCCTGCGCGCCCACCAGAAGAGC
GCGCGGCACCGGCCGCCCAGCACCGCGCTGCAGGCACACTCGCCCGCGCTGCCCGCCCCG
CACGCGCACGCGCCCGCGCTCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCGCAC
CACCTGCCGGCCATGGTGCTGTGAGCGCGCCCGCGCCCCCGCCGGGCCCCGCGCGCTCCT
GGGTCCCCGGCACCCCGGCCCCGCAGCGCGACTCGCCCTCCAGCCCCAACCCCCGGCCCG
GCGCCGCCGCGGAGCCCCGCGCGCTGGGGTTGCGCCCCGGAGGCGGATCTCAGGCACCCC
CGCCTTGGCCCGTGTCGCAGATGAGGACACTGAGGGCGGCGTCCCTCACCCAGGCCACGC
AGCTGGTGCGGCTGTTCGGCCGCCTCCTCTGGGAGGGGGTCCCCCTGCCTGGCCTCGCCC
CCGAGTCTCCCTGCTGCTGTAGAGCCGGGCGCCCAGGCCGGCATCCCCCTCGTGGGTGGC
AGGAGAGCGGACTTAGAGCCCCCGAGGGCCCCTCAGCAGAGGAAGGGGAGTCCCCTCCTC
CGCCACCGAGAGTCCTGTGCTTCGGAATGAAGGGAGGGCGACCTCCTTGTCCGGGTGTGG
TCGGGCGCGGGGGTTGTGGGGGCGCCATCTCCTCTTCCGGCCCCTGGGACTGGTGTCCTG
AAGTGTCGGGAGTCCTTACGCAACCTTGACATGTGCGGGCTACTGGGGTCCATCGGCAGC
GGGAAGAGACCCGGAGAGATGCATCTTCTGGGCCCTTCTCTCCTTTAGGCCAGCTTACCC
CCAAACCTGGCTCCTGGGGACGGATGAGGAAGGAGCTCTTTGCAGTGCACCAGGCACGTT
GAGAGTGGAGGCACAATGGAAATCCTCTGTGGGACCCCGAGCAAGACCCTGCACCTCTTT
GGGCCTCAGTTTCCCCATCTGTAAAATGAAGGAGTTGGACCAATGCCCCCTCCCCTTCAG
CTGTGACATCGTGCCTGGGAAGGCGAAATATACCCCCAGCCCCTTCCAACACACACACTC
CAGCGAGAGGAGGGCAAGACTGGAACCGCTGCCCGAGAGGTTAAGGTGGCTTCTGTGGCC
ACGAAGCGCTTCCGAGCTGTGCCCAGTCCCGGGAATTCCGCCCAGTCTGCCCACACTTCC
CTCGGTCCCTGCCCGTTTCCTCAAATTCGGGCCGTGCGCGCCCTCTGGTGTCGCCTCTCA
CACTTTGCAGTCATTTACCAGGATTCCCGTAGGGCGTTTTGTAAAATAAACTATAATATT
AATGAAAAGTATAAAATGTATAGAGTTTTCAAGAAACTGCGTTCTACTTCCAGAAGATGG
TCACTTTAACCTTGTAAATATTTATCTAAAATGATATTTACAAAACTGTAATATATTATT
ATTTGATTGTATATGTACAACTGTAAATACATTTGTACCTCTCTTGTATTCTAAAATAAA
AATTACTTGGAACATTTATCATTTAGCATCTG

Protein Sequence

>59335 : length: 367
MMGSVLPAEALVLKTGLKAPGLALAEVITSDILHSFLYGRWRNVLGEQLFEDKSHHASPK
TAFTAEVLAQSFSGEVQKLSSLVLPAEVIIAQSSIPGEGLGIFSKTWIKAGTEMGPFTGR
VIAPEHVDICKNNNLMWEVFNEDGTVRYFIDASQEDHRSWMTYIKCARNEQEQNLEVVQI
GTSIFYKAIEMIPPDQELLVWYGNSHNTFLGIPGVPGLEEDQKKNKHEDFHPADSAAGPA
GRMRCVICHRGFNSRSNLRSHMRIHTLDKPFVCRFCNRRFSQSSTLRNHVRLHTGERPYK
CQVCQSAYSQLAGLRAHQKSARHRPPSTALQAHSPALPAPHAHAPALAAAAAAAAAAAAH
HLPAMVL