ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5914

Name

RARA

Synonym

NR1B1|RAR;retinoic acid receptor, alpha;RARA;retinoic acid receptor, alpha

Definition

RAR-alpha|nuclear receptor subfamily 1 group B member 1|nucleophosmin-retinoic acid receptor alpha fusion protein NPM-RAR long form|retinoic acid nuclear receptor alpha variant 1|retinoic acid nuclear receptor alpha variant 2|retinoic acid receptor alpha|

Position

17q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Vitamin D metabolism and pathway;PANTHER;P04396

Pathway

transcription regulation by methyltransferase of carm1;PID BioCarta;100220

Pathway

map kinase inactivation of smrt corepressor;PID BioCarta;100032

Pathway

RXR and RAR heterodimerization with other nuclear receptor;PID Curated;200112

Pathway

nuclear receptors coordinate the activities of chromatin remodeling complexes and coactivators to facilitate initiation of transcription in carcinoma cells;PID BioCarta;100048

Pathway

Retinoic acid receptors-mediated signaling;PID Curated;200142

Pathway

degradation of the rar and rxr by the proteasome;PID BioCarta;100049

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Gene Expression;Reactome;REACT:71

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

Cancers;KEGG DISEASE

Disease

Leukemia, acute promyelocytic;OMIM

Disease

Prostate cancer;FunDO

Disease

Acute myeloid leukemia (AML);KEGG DISEASE;H00003

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

Disease

Rheumatoid arthritis;FunDO

Disease

Obesity;FunDO

Disease

Leukemia;FunDO

Disease

cleft lip with cleft palate cleft lip without cleft palate;GAD

Disease

Breast cancer;FunDO

Disease

DEVELOPMENTAL;GAD

Disease

Leukoencephalopathy;FunDO

Disease

Esophagus cancer;FunDO

External Links

Links to cell senescence gene database

5914

Links to epithelial mesenchymal transition gene database

5914

Links to ovarian cancer gene database

5914

Links to endometrial cancer gene database

5914

Links to iHOP

5914

Sequence Information

Nucleotide Sequence

>5914 : length: 3494
CTCGGTTCCCTGCGTTTCTCCCGCTGCAGCCGGACGCGCCGGGAATGGGTTAAGCCAGGG
GCGGTGCCTGGACGGGGCGGGGCGGTGGAAAGGGGGTGGTGCCCGGAGGGGAGGGGGCGC
GCAGAGCTGGGGTGGGGGGGCCGTGGCGCGTACCACCAGAGACCGAGCGAGTCGCCAGCT
GCCCCTGGCCTGGCGGGGGCGGAACCGCGCGGGATCCCCACCCCCACCCGGAATCCTCGC
CACGGAGAATCCCTGGAGAAGCCCCGGATCCCCGGCTGGGAGGAGGAAGTGCTCGTTGAC
CCCCAGCCCCGCGCTGATCCCGCCCCCGGCCTGCGGACTTGGGGAGCCGCTGTACTCTGC
CTCGGACGCCACGAGACTCTAGACGGGAGTCCCCTCGAGGTGAAGCCGCTGAGTTCCCGG
GCCCCGCCAGGCTTCCCTGGGAGAGCCGACGGACCCCCCCTCCCAGCACACACAACTTCC
CTGCTTTTCACCGGGACTGGCGGAGCGGCCGGCGGACTTAGACGCGGGGACTTCAGGGCA
GGGGGCGCCCCCTGCCCGGGTCACCAGTCGGGGCGAGGGGACGTCTCCTCTCCCCCAGCT
GCTCTGCTCGGATGGCGCCGCCGGCTGAGTGACGGGGGCGGCGCGCAGGACTTCCCAGCT
CGGACCTCTTGCCTTCGAGGGGAAAGATGTACGAGAGTGTAGAAGTGGGGGGTCCCACCC
CTAATCCCTTCCTAGTGGTGGATTTTTATAACCAGAACCGGGCCTGTTTGCTCCCAGAGA
AGGGGCTCCCCGCCCCGGGTCCGTACTCCACCCCGCTCCGGACTCCGCTTTGGAATGGCT
CAAACCACTCCATTGAGACCCAGAGCAGCAGTTCTGAAGAGATAGTGCCCAGCCCTCCCT
CGCCACCCCCTCTACCCCGCATCTACAAGCCTTGCTTTGTCTGTCAGGACAAGTCCTCAG
GCTACCACTATGGGGTCAGCGCCTGTGAGGGCTGCAAGGGCTTCTTCCGCCGCAGCATCC
AGAAGAACATGGTGTACACGTGTCACCGGGACAAGAACTGCATCATCAACAAGGTGACCC
GGAACCGCTGCCAGTACTGCCGACTGCAGAAGTGCTTTGAAGTGGGCATGTCCAAGGAGT
CTGTGAGAAACGACCGAAACAAGAAGAAGAAGGAGGTGCCCAAGCCCGAGTGCTCTGAGA
GCTACACGCTGACGCCGGAGGTGGGGGAGCTCATTGAGAAGGTGCGCAAAGCGCACCAGG
AAACCTTCCCTGCCCTCTGCCAGCTGGGCAAATACACTACGAACAACAGCTCAGAACAAC
GTGTCTCTCTGGACATTGACCTCTGGGACAAGTTCAGTGAACTCTCCACCAAGTGCATCA
TTAAGACTGTGGAGTTCGCCAAGCAGCTGCCCGGCTTCACCACCCTCACCATCGCCGACC
AGATCACCCTCCTCAAGGCTGCCTGCCTGGACATCCTGATCCTGCGGATCTGCACGCGGT
ACACGCCCGAGCAGGACACCATGACCTTCTCGGACGGGCTGACCCTGAACCGGACCCAGA
TGCACAACGCTGGCTTCGGCCCCCTCACCGACCTGGTCTTTGCCTTCGCCAACCAGCTGC
TGCCCCTGGAGATGGATGATGCGGAGACGGGGCTGCTCAGCGCCATCTGCCTCATCTGCG
GAGACCGCCAGGACCTGGAGCAGCCGGACCGGGTGGACATGCTGCAGGAGCCGCTGCTGG
AGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCACATGTTCCCCAAGA
TGCTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCA
CGCTGAAGATGGAGATCCCGGGCTCCATGCCGCCTCTCATCCAGGAAATGTTGGAGAACT
CAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCGGGACGGGGGTGGCC
TGGCCCCCCCGCCAGGCAGCTGTAGCCCCAGCCTCAGCCCCAGCTCCAACAGAAGCAGCC
CGGCCACCCACTCCCCGTGACCGCCCACGCCACATGGACACAGCCCTCGCCCTCCGCCCC
GGCTTTTCTCTGCCTTTCTACCGACCATGTGACCCCGCACCAGCCCTGCCCCCACCTGCC
CTCCCGGGCAGTACTGGGGACCTTCCCTGGGGGACGGGGAGGGAGGAGGCAGCGACTCCT
TGGACAGAGGCCTGGGCCCTCAGTGGACTGCCTGCTCCCACAGCCTGGGCTGACGTCAGA
GGCCGAGGCCAGGAACTGAGTGAGGCCCCTGGTCCTGGGTCTCAGGATGGGTCCTGGGGG
CCTCGTGTTCATCAAGACACCCCTCTGCCCAGCTCACCACATCTTCATCACCAGCAAACG
CCAGGACTTGGCTCCCCCATCCTCAGAACTCACAAGCCATTGCTCCCCAGCTGGGGAACC
TCAACCTCCCCCCTGCCTCGGTTGGTGACAGAGGGGGTGGGACAGGGGCGGGGGGTTCCC
CCTGTACATACCCTGCCATACCAACCCCAGGTATTAATTCTCGCTGGTTTTGTTTTTATT
TTAATTTTTTTGTTTTGATTTTTTTAATAAGAATTTTCATTTTAAGCACATTTATACTGA
AGGAATTTGTGCTGTGTATTGGGGGGAGCTGGATCCAGAGCTGGAGGGGGTGGGTCCGGG
GGAGGGAGTGGCTCGGAAGGGGCCCCCACTCTCCTTTCATGTCCCTGTGCCCCCCAGTTC
TCCTCCTCAGCCTTTTCCTCCTCAGTTTTCTCTTTAAAACTGTGAAGTACTAACTTTCCA
AGGCCTGCCTTCCCCTCCCTCCCACTGGAGAAGCCGCCAGCCCCTTTCTCCCTCTGCCTG
ACCACTGGGTGTGGACGGTGTGGGGCAGCCCTGAAAGGACAGGCTCCTGGCCTTGGCACT
TGCCTGCACCCACCATGAGGCATGGAGCAGGGCAGAGCAAGGGCCCCGGGACAGAGTTTT
CCCAGACCTGGCTCCTCGGCAGAGCTGCCTCCCGTCAGGGCCCACATCATCTAGGCTCCC
CAGCCCCCACTGTGAAGGGGCTGGCCAGGGGCCCGAGCTGCCCCCACCCCCGGCCTCAGC
CACCAGCACCCCCATAGGGCCCCCAGACACCACACACATGCGCGTGCGCACACACACAAA
CACACACACACTGGACAGTAGATGGGCCGACACACACTTGGCCCGAGTTCCTCCATTTCC
CTGGCCTGCCCCCCACCCCCAACCTGTCCCACCCCCGTGCCCCCTCCTTACCCCGCAGGA
CGGGCCTACAGGGGGGTCTCCCCTCACCCCTGCACCCCCAGCTGGGGGAGCTGGCTCTGC
CCCGACCTCCTTCACCAGGGGTTGGGGCCCCTTCCCCTGGAGCCCGTGGGTGCACCTGTT
ACTGTTGGGCTTTCCACTGAGATCTACTGGATAAAGAATAAAGTTCTATTTATTCTAAAA
AAAAAAAAAAAAAA

Protein Sequence

>5914 : length: 478
MMSQTMTQAGVSFRHSVRAAQCHTRVPNTWPRATRPYASCRRSPRLRGRWPGSAGQGAGG
RAPRAGWRAGDVTGSAIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSA
CEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNK
KKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDL
WDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTM
TFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQ
PDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPG
SMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP