ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5900

Name

RALGDS

Synonym

RGDS|RGF|RalGEF;ral guanine nucleotide dissociation stimulator;RALGDS;ral guanine nucleotide dissociation stimulator

Definition

ral guanine nucleotide exchange factor

Position

9q34.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

p38MAPK events;PID Reactome;500627

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

Ras Pathway;PANTHER;P04393

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

ras signaling pathway;PID BioCarta;100047

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Disease

Melanoma;FunDO

Disease

Neoplasm metastasis;FunDO

External Links

Links to cell senescence gene database

5900

Links to epithelial mesenchymal transition gene database

5900

Links to ovarian cancer gene database

5900

Links to endometrial cancer gene database

5900

Links to iHOP

5900

Sequence Information

Nucleotide Sequence

>5900 : length: 3730
GCGGGCTCACAGCGGTGGCAAAGCCCAGCCGCGCGGGCCGCGCCGCCGCCCCCGCCGCGC
GCCGGGCCGGCCCCGCGCCCGCGCTGCGAGCCTTCCATGGTGCAGCGCATGTGGGCCGAG
GCGGCCGGGCCTGCTGGCGGCGCCGAGCCGCTGTTTCCGGGCTCCCGGCGGAGCCGCAGC
GTGTGGGACGCCGTGCGCCTGGAGGTGGGCGTCCCCGACAGCTGCCCGGTGGTGCTGCAC
AGCTTCACGCAGCTAGACCCCGACCTGCCGCGCCCGGAGAGCTCCACGCAGGAGATCGGT
GAGGAGCTGATCAACGGAGTCATCTACTCCATCTCCCTGCGCAAGGTGCAGCTGCACCAC
GGAGGCAACAAGGGGCAGCGCTGGCTCGGGTATGAGAATGAGTCGGCCCTGAACCTTTAT
GAGACTTGCAAGGTGCGGACCGTGAAGGCTGGCACGCTGGAGAAGCTGGTGGAGCACCTG
GTGCCAGCCTTCCAGGGCAGCGACCTCTCCTACGTCACCATCTTCCTGTGTACCTATAGA
GCCTTCACCACCACCCAACAGGTCCTGGACCTGCTGTTCAAAAGGTACGGTAGATGTGAC
GCCCTCACGGCCTCCTCTAGATACGGCTGCATCCTCCCCTATTCCGACGAGGATGGTGGA
CCCCAGGACCAACTTAAAAATGCCATCTCCTCCATCCTGGGCACCTGGCTGGACCAGTAC
TCGGAGGATTTCTGTCAACCTCCGGACTTTCCCTGCCTCAAGCAGCTGGTGGCCTACGTG
CAGCTCAACATGCCAGGCTCAGACCTGGAGCGCCGTGCCCACCTTCTCCTGGCCCAGCTG
GAGCACTCGGAACCCATTGAGGCAGAGCCTGAGGCTCTGTCACCAGTGCCAGCTCTAAAA
CCAACTCCAGAGCTCGAGCTAGCTCTAACACCAGCTCGAGCACCCAGCCCAGTGCCGGCT
CCAGCCCCGGAGCCAGAGCCAGCTCCAACACCAGCTCCAGGTTCAGAGCTAGAAGTAGCT
CCAGCACCAGCTCCGGAGCTCCAGCAGGCTCCAGAGCCAGCTGTGGGACTAGAATCGGCT
CCAGCGCCAGCTCTGGAACTAGAGCCAGCTCCAGAACAGGATCCAGCTCCCTCACAAACT
CTAGAGCTGGAGCCAGCTCCAGCACCAGTTCCATCATTACAGCCTTCCTGGCCTTCACCT
GTGGTTGCAGAGAACGGGCTGAGTGAGGAGAAGCCTCACCTCTTGGTGTTCCCTCCAGAT
CTGGTGGCAGAGCAGTTTACACTGATGGATGCGGAACTGTTCAAGAAGGTGGTGCCCTAC
CACTGCCTGGGCTCCATCTGGTCCCAGCGGGACAAGAAGGGCAAGGAGCACCTGGCGCCC
ACCATCCGCGCCACTGTCACCCAGTTCAACAGTGTGGCCAACTGTGTCATCACCACCTGC
CTCGGGAACCGAAGCACGAAAGCCCCAGACAGGGCCAGGGTGGTGGAGCACTGGATCGAG
GTGGCCAGGGAGTGCCGGATCCTCAAGAACTTCTCGTCACTGTATGCCATCCTCTCTGCC
CTGCAGAGCAACTCCATCCACCGTCTGAAGAAGACGTGGGAAGACGTTTCCAGGGACAGT
TTCCGGATCTTTCAGAAGCTGTCAGAGATCTTCTCAGATGAGAACAACTACTCATTGAGC
CGGGAGCTGCTCATCAAGGAGGGCACCTCCAAGTTTGCCACCCTGGAGATGAACCCCAAG
AGAGCCCAGAAACGGCCGAAGGAGACGGGCATCATCCAGGGCACCGTTCCCTACCTGGGC
ACGTTCCTCACCGACCTGGTGATGCTGGACACTGCCATGAAGGACTATCTGTATGGCAGA
CTCATCAACTTTGAGAAGAGGAGGAAGGAGTTCGAGGTGATCGCCCAGATCAAGCTGCTG
CAGTCGGCCTGCAACAACTACAGCATCGCGCCAGATGAGCAATTTGGGGCCTGGTTCCGG
GCCGTGGAGCGGCTCAGCGAGACTGAGAGCTACAACCTGTCGTGCGAGCTGGAGCCCCCA
TCCGAGTCAGCCAGCAACACCCTCAGGACCAAGAAGAACACAGCCATTGTCAAGCGCTGG
AGCGACCGCCAGGCCCCCAGCACTGAGCTCAGTACCAGTGGCAGCTCCCACTCCAAGTCC
TGTGACCAGCTCAGGTGTGGCCCCTACCTCAGCAGCGGGGACATCGCTGACGCGCTCAGC
GTGCACTCGGCCGGCTCCTCTAGCTCCGACGTGGAGGAGATCAACATCAGCTTCGTCCCG
GAGTCTCCTGATGGCCAGGAAAAGAAGTTCTGGGAATCAGCCTCACAGTCATCCCCGGAG
ACCTCCGGCATCAGCTCAGCCTCCAGCAGCACCTCGTCCTCCTCAGCCTCCACCACGCCC
GTGGCTGCCACACGCACCCACAAGCGCTCTGTCTCAGGGCTCTGCAACTCCAGCTCCGCG
CTGCCGCTCTACAACCAGCAGGTGGGCGACTGCTGTATCATCCGCGTCAGCCTGGACGTG
GACAATGGCAACATGTACAAGAGCATCCTGGTGACCAGCCAAGATAAGGCTCCGGCTGTA
ATCCGCAAGGCCATGGACAAACACAACCTGGAGGAGGAGGAGCCGGAGGACTATGAGCTG
CTGCAGATTCTCTCAGATGACCGGAAGCTGAAGATCCCTGAAAACGCCAACGTCTTCTAT
GCCATGAACTCTACCGCCAACTATGACTTTGTCCTCAAGAAGCGGACCTTCACCAAGGGA
GTGAAGGTCAAGCACGGAGCCAGCTCCACCCTCCCTCGCATGAAGCAGAAAGGACTCAAG
ATTGCCAAGGGCATCTTCTGAGGGCATCCTCCCAGGGTCTGGCTGGCTGGTAGCCAAGCA
CTTATGGACCAGAGTGGCCCAGGCCAGCTGGGCGCCTTCCTCCCACCTGCCAGCCCAGGG
TACCCCAGACTCCAGTTTCATCCTGAACCTCTCCCGCTGCTGGGATTGACGCCTGCCATT
GGTCAGGCTGACCTGGCCTCCCGTGGACCACTCGCTGCCTTAGGTGCCTTCTGCTCTCTG
GAACCAGAGGACTAGCTGACTTTTGCCAAGGAGCAGTGCCAACGGGCATGGCATGGTGCC
CTGCCTGCCCCCGGGCGCCACCTCTGTACACTTCCCTGACACCTTCCCAGGTGTGGGTCA
CTGCCACCTGTGCCCATGGGCACCCCAGAGCACCCACTGTGACCACTGCAGTTCTCTCAT
GCCCACAGGCACTGGCCTGTGACCTTCGCAGGGGTCCCGGCCCCTCCCACCACTCTAGCC
TTTCTCAGGCTGCACCAAAGATTCCATCATCAGGGCCAACTGAGAGTGAGGGAGTCTCAC
CCACCGCTTACCCCAGCCCTCCCCTGGGAGCAGAGAGAGAAACCCTCTTCATGGACCAGA
CTCTGCACCCGGTGAGTGAGGACAGTCCCAGCTGAGTCCCATCGATGTTGAATCTCATGC
CACTGCAAGTGCCATTCACCACTGCGTCCTGGGCTTTACGAGACCATGCAAGACGGGGGT
TAGTGAGGAAGGAGGATTTGGGGTGGGGGTGGGGTGATTGAATATTTGTATAAAAAGCAA
AAAGAAAAAAAAAATGTTTGTTTACTGATTGGGGAGGGGCAATATTTATTTGTTGTAAAT
AGCAAATGCTAGACTTGAATATTATATTAAAATCCTGTTTCTACTATAAAAAAAAAAAAA
AAAAAAAAAA

Protein Sequence

>5900 : length: 914
MVQRMWAEAAGPAGGAEPLFPGSRRSRSVWDAVRLEVGVPDSCPVVLHSFTQLDPDLPRP
ESSTQEIGEELINGVIYSISLRKVQLHHGGNKGQRWLGYENESALNLYETCKVRTVKAGT
LEKLVEHLVPAFQGSDLSYVTIFLCTYRAFTTTQQVLDLLFKRYGRCDALTASSRYGCIL
PYSDEDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGSDLERR
AHLLLAQLEHSEPIEAEPEALSPVPALKPTPELELALTPARAPSPVPAPAPEPEPAPTPA
PGSELEVAPAPAPELQQAPEPAVGLESAPAPALELEPAPEQDPAPSQTLELEPAPAPVPS
LQPSWPSPVVAENGLSEEKPHLLVFPPDLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDK
KGKEHLAPTIRATVTQFNSVANCVITTCLGNRSTKAPDRARVVEHWIEVARECRILKNFS
SLYAILSALQSNSIHRLKKTWEDVSRDSFRIFQKLSEIFSDENNYSLSRELLIKEGTSKF
ATLEMNPKRAQKRPKETGIIQGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFE
VIAQIKLLQSACNNYSIAPDEQFGAWFRAVERLSETESYNLSCELEPPSESASNTLRTKK
NTAIVKRWSDRQAPSTELSTSGSSHSKSCDQLRCGPYLSSGDIADALSVHSAGSSSSDVE
EINISFVPESPDGQEKKFWESASQSSPETSGISSASSSTSSSSASTTPVAATRTHKRSVS
GLCNSSSALPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEE
EEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFTKGVKVKHGASSTLP
RMKQKGLKIAKGIF