ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5879

Name

RAC1

Synonym

MIG5|Rac-1|TC-25|p21-Rac1;ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1);RAC1;ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)

Definition

cell migration-inducing gene 5 protein|ras-like protein TC25|ras-related C3 botulinum toxin substrate 1

Position

7p22

Gene Type

protein-coding

Pathways and Diseases

Pathway

influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054

Pathway

Fc gamma R-mediated phagocytosis;KEGG PATHWAY;hsa04666

Pathway

Axon guidance mediated by netrin;PANTHER;P00009

Pathway

Regulation of p38-alpha and p38-beta;PID Curated;200054

Pathway

role of pi3k subunit p85 in regulation of actin organization and cell migration;PID BioCarta;100211

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

PDGFR-beta signaling pathway;PID Curated;200127

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

Bacterial invasion of epithelial cells;KEGG PATHWAY;hsa05100

Pathway

N-cadherin signaling events;PID Curated;200180

Pathway

EPHB forward signaling;PID Curated;200041

Pathway

ras-independent pathway in nk cell-mediated cytotoxicity;PID BioCarta;100095

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Ephrin B reverse signaling;PID Curated;200173

Pathway

EPHA2 forward signaling;PID Curated;200185

Pathway

Lissencephaly gene (LIS1) in neuronal migration and development;PID Curated;200114

Pathway

Endothelins;PID Curated;200004

Pathway

p38 mapk signaling pathway;PID BioCarta;100085

Pathway

Activation of Rac;PID Reactome;500095

Pathway

S1P3 pathway;PID Curated;200035

Pathway

Signaling by Robo receptor;PID Reactome;500092

Pathway

bcr signaling pathway;PID BioCarta;100227

Pathway

E-cadherin signaling in the nascent adherens junction;PID Curated;200105

Pathway

Huntington disease;PANTHER;P00029

Pathway

Paxillin-independent events mediated by a4b1 and a4b7;PID Curated;200178

Pathway

Inactivation of Cdc42 and Rac;PID Reactome;500094

Pathway

Pancreatic secretion;KEGG PATHWAY;hsa04972

Pathway

Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620

Pathway

p38 MAPK signaling pathway;PID Curated;200014

Pathway

mcalpain and friends in cell motility;PID BioCarta;100111

Pathway

IL2 signaling events mediated by PI3K;PID Curated;200099

Pathway

Paxillin-dependent events mediated by a4b1;PID Curated;200117

Pathway

Arf1 pathway;PID Curated;200167

Pathway

Syndecan-4-mediated signaling events;PID Curated;200115

Pathway

Nephrin/Neph1 signaling in the kidney podocyte;PID Curated;200132

Pathway

DCC mediated attractive signaling;PID Reactome;500089

Pathway

Axon guidance mediated by Slit/Robo;PANTHER;P00008

Pathway

Regulation of RAC1 activity;PID Curated;200165

Pathway

HIV Infection;Reactome;REACT:6185

Pathway

Signaling events mediated by PRL;PID Curated;200006

Pathway

BCR signaling pathway;PID Curated;200005

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

mapkinase signaling pathway;PID BioCarta;100113

Pathway

Shigellosis;KEGG PATHWAY;hsa05131

Pathway

B cell activation;PANTHER;P00010

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

ucalpain and friends in cell spread;PID BioCarta;100008

Pathway

Epithelial cell signaling in Helicobacter pylori infection;KEGG PATHWAY;hsa05120

Pathway

Thromboxane A2 receptor signaling;PID Curated;200069

Pathway

Noncanonical Wnt signaling pathway;PID Curated;200016

Pathway

phospholipids as signalling intermediaries;PID BioCarta;100183

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Axon guidance mediated by semaphorins;PANTHER;P00007

Pathway

Viral myocarditis;KEGG PATHWAY;hsa05416

Pathway

IL6-mediated signaling events;PID Curated;200124

Pathway

agrin in postsynaptic differentiation;PID BioCarta;100252

Pathway

B cell receptor signaling pathway;KEGG PATHWAY;hsa04662

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

Signal transduction by L1;PID Reactome;500100

Pathway

fmlp induced chemokine gene expression in hmc-1 cells;PID BioCarta;100162

Pathway

E-cadherin signaling in keratinocytes;PID Curated;200125

Pathway

Class I PI3K signaling events;PID Curated;200098

Pathway

p75(NTR)-mediated signaling;PID Curated;200103

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

a6b1 and a6b4 Integrin signaling;PID Curated;200162

Pathway

S1P1 pathway;PID Curated;200071

Pathway

Nectin adhesion pathway;PID Curated;200053

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

Amyotrophic lateral sclerosis (ALS);KEGG PATHWAY;hsa05014

Pathway

tumor suppressor arf inhibits ribosomal biogenesis;PID BioCarta;100237

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

CDC42 signaling events;PID Curated;200057

Pathway

how does salmonella hijack a cell;PID BioCarta;100037

Pathway

S1P2 pathway;PID Curated;200181

Pathway

angiotensin ii mediated activation of jnk pathway via pyk2 dependent signaling;PID BioCarta;100236

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

ras signaling pathway;PID BioCarta;100047

Pathway

Phagosome;KEGG PATHWAY;hsa04145

Pathway

Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664

Pathway

Hemostasis;Reactome;REACT:604

Pathway

role of mal in rho-mediated activation of srf;PID BioCarta;100114

Pathway

CD28 dependent Vav1 pathway;PID Reactome;500486

Pathway

RAC1 signaling pathway;PID Curated;200190

Pathway

Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Signaling events regulated by Ret tyrosine kinase;PID Curated;200058

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Signaling by Rho GTPases;Reactome;REACT:11044

Pathway

Osteopontin-mediated events;PID Curated;200042

Pathway

T cell activation;PANTHER;P00053

Pathway

Neurotrophic factor-mediated Trk receptor signaling;PID Curated;200128

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

Signaling events mediated by focal adhesion kinase;PID Curated;200192

Pathway

Arf6 downstream pathway;PID Curated;200079

Pathway

map kinase inactivation of smrt corepressor;PID BioCarta;100032

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

Nef and signal transduction;PID Reactome;500755

Pathway

VEGF signaling pathway;KEGG PATHWAY;hsa04370

Pathway

phosphoinositides and their downstream targets;PID BioCarta;100059

Pathway

links between pyk2 and map kinases;PID BioCarta;100057

Pathway

rac1 cell motility signaling pathway;PID BioCarta;100056

Pathway

t cell receptor signaling pathway;PID BioCarta;100022

Pathway

mTOR signaling pathway;PID Curated;200080

Pathway

Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

y branching of actin filaments;PID BioCarta;100254

Pathway

SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion;PID Reactome;500075

Pathway

Ras Pathway;PANTHER;P04393

Pathway

Cytoskeletal regulation by Rho GTPase;PANTHER;P00016

Pathway

Netrin-mediated signaling;PID Curated;200074

Disease

Mental retardation;FunDO

Disease

Adenovirus infection;FunDO

Disease

Cancer;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

Salmonella infection;FunDO

External Links

Links to cell senescence gene database

5879

Links to epithelial mesenchymal transition gene database

5879

Links to ovarian cancer gene database

5879

Links to endometrial cancer gene database

5879

Links to iHOP

5879

Sequence Information

Nucleotide Sequence

>5879 : length: 2398
GGGAGGCCGGATGTGAGTGGAGCGGCCATTTCCTGTTTCTCTGCAGTTTTCCTCAGCTTT
GGGTGGTGGCCGCTGCCGGGCATCGGCTTCCAGTCCGCGGAGGGCGAGGCGGCGTGGACA
GCGGCCCCGGCACCCAGCGCCCCGCCGCCCGCAAGCCGCGCGCCCGTCCGCCGCGCCCCG
AGCCCGCCGCTTCCTATCTCAGCGCCCTGCCGCCGCCGCCGCGGCCCAGCGAGCGGCCCT
GATGCAGGCCATCAAGTGTGTGGTGGTGGGAGACGGAGCTGTAGGTAAAACTTGCCTACT
GATCAGTTACACAACCAATGCATTTCCTGGAGAATATATCCCTACTGTCTTTGACAATTA
TTCTGCCAATGTTATGGTAGATGGAAAACCGGTGAATCTGGGCTTATGGGATACAGCTGG
ACAAGAAGATTATGACAGATTACGCCCCCTATCCTATCCGCAAACAGTTGGAGAAACGTA
CGGTAAGGATATAACCTCCCGGGGCAAAGACAAGCCGATTGCCGATGTGTTCTTAATTTG
CTTTTCCCTTGTGAGTCCTGCATCATTTGAAAATGTCCGTGCAAAGTGGTATCCTGAGGT
GCGGCACCACTGTCCCAACACTCCCATCATCCTAGTGGGAACTAAACTTGATCTTAGGGA
TGATAAAGACACGATCGAGAAACTGAAGGAGAAGAAGCTGACTCCCATCACCTATCCGCA
GGGTCTAGCCATGGCTAAGGAGATTGGTGCTGTAAAATACCTGGAGTGCTCGGCGCTCAC
ACAGCGAGGCCTCAAGACAGTGTTTGACGAAGCGATCCGAGCAGTCCTCTGCCCGCCTCC
CGTGAAGAAGAGGAAGAGAAAATGCCTGCTGTTGTAAATGTCTCAGCCCCTCGTTCTTGG
TCCTGTCCCTTGGAACCTTTGTACGCTTTGCTCAAAAAAAAACAAAAAAAAAAAACAAAA
AAAAAAAACAACGGTGGAGCCTTCGCACTCAATGCCAACTTTTTGTTACAGATTAATTTT
TCCATAAAACCATTTTTTGAACCAATCAGTAATTTTAAGGTTTTGTTTGTTCTAAATGTA
AGAGTTCAGACTCACATTCTATTAAAATTTAGCCCTAAAATGACAAGCCTTCTTAAAGCC
TTATTTTTCAAAAGCGCCCCCCCCATTCTTGTTCAGATTAAGAGTTGCCAAAATACCTTC
TGAACTACACTGCATTGTTGTGCCGAGAACACCGAGCACTGAACTTTGCAAAGACCTTCG
TCTTTGAGAAGACGGTAGCTTCTGCAGTTAGGAGGTGCAGACACTTGCTCTCCTATGTAG
TTCTCAGATGCGTAAAGCAGAACAGCCTCCCGAATGAAGCGTTGCCATTGAACTCACCAG
TGAGTTAGCAGCACGTGTTCCCGACATAACATTGTACTGTAATGGAGTGAGCGTAGCAGC
TCAGCTCTTTGGATCAGTCTTTGTGATTTCATAGCGAGTTTTCTGACCAGCTTTTGCGGA
GATTTTGAACAGAACTGCTATTTCCTCTAATGAAGAATTCTGTTTAGCTGTGGGTGTGCC
GGGTGGGGTGTGTGTGATCAAAGGACAAAGACAGTATTTTGACAAAATACGAAGTGGAGA
TTTACACTACATTGTACAAGGAATGAAAGTGTCACGGGTAAAAACTCTAAAAGGTTAATT
TCTGTCAAATGCAGTAGATGATGAAAGAAAGGTTGGTATTATCAGGAAATGTTTTCTTAA
GCTTTTCCTTTCTCTTACACCTGCCATGCCTCCCCAAATTGGGCATTTAATTCATCTTTA
AACTGGTTGTTCTGTTAGTCGCTAACTTAGTAAGTGCTTTTCTTATAGAACCCCTTCTGA
CTGAGCAATATGCCTCCTTGTATTATAAAATCTTTCTGATAATGCATTAGAAGGTTTTTT
TGTCGATTAGTAAAAGTGCTTTCCATGTTACTTTATTCAGAGCTAATAAGTGCTTTCCTT
AGTTTTCTAGTAACTAGGTGTAAAAATCATGTGTTGCAGCTTTATAGTTTTTAAAATATT
TTAGATAATTCTTAAACTATGAACCTTCTTAACATCACTGTCTTGCCAGATTACCGACAC
TGTCACTTGACCAATACTGACCCTCTTTACCTCGCCCACGCGGACACACGCCTCCTGTAG
TCGCTTTGCCTATTGATGTTCCTTTGGGTCTGTGAGGTTCTGTAAACTGTGCTAGTGCTG
ACGATGTTCTGTACAACTTAACTCACTGGCGAGAATACAGCGTGGGACCCTTCAGCCACT
ACAACAGAATTTTTTAAATTGACAGTTGCAGAATTGTGGAGTGTTTTTACATTGATCTTT
TGCTAATGCAATTAGCATTATGTTTTGCATGTATGACTTAATAAATCCTTGAATCATA

Protein Sequence

>5879 : length: 211
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTVGETYGKDITSRGKDKPIADVFLICFSLVSPASFENVRAKWYPEV
RHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALT
QRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL