ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

581

Name

BAX

Synonym

BCL2L4;BCL2-associated X protein;BAX;BCL2-associated X protein

Definition

BCL2-associated X protein omega|Baxdelta2G9|Baxdelta2G9omega|Baxdelta2omega|apoptosis regulator BAX|bcl-2-like protein 4|bcl2-L-4

Position

19q13.3-q13.4

Gene Type

protein-coding

Pathways and Diseases

Pathway

Apoptosis;Reactome;REACT:578

Pathway

Glucocorticoid receptor regulatory network;PID Curated;200077

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

Ceramide signaling pathway;PID Curated;200100

Pathway

Huntington's disease;KEGG PATHWAY;hsa05016

Pathway

Huntington disease;PANTHER;P00029

Pathway

Apoptosis;KEGG PATHWAY;hsa04210

Pathway

Caspase cascade in apoptosis;PID Curated;200148

Pathway

Amyotrophic lateral sclerosis (ALS);KEGG PATHWAY;hsa05014

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

p53 pathway;PANTHER;P00059

Pathway

Signaling events mediated by HDAC Class III;PID Curated;200020

Pathway

hypoxia and p53 in the cardiovascular system;PID BioCarta;100084

Pathway

role of mitochondria in apoptotic signaling;PID BioCarta;100106

Pathway

regulation of cell cycle progression by plk3;PID BioCarta;100068

Pathway

Protein processing in endoplasmic reticulum;KEGG PATHWAY;hsa04141

Pathway

apoptotic signaling in response to dna damage;PID BioCarta;100204

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Prion diseases;KEGG PATHWAY;hsa05020

Pathway

regulation of bad phosphorylation;PID BioCarta;100233

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

p53 signaling pathway;KEGG PATHWAY;hsa04115

Pathway

ceramide signaling pathway;PID BioCarta;100206

Pathway

Syndecan-2-mediated signaling events;PID Curated;200164

Pathway

Activation, translocation and oligomerization of BAX;PID Reactome;501012

Disease

Colorectal cancer;KEGG DISEASE;H00020

Disease

Epstein-Barr virus infection;FunDO

Disease

Colorectal cancer;OMIM

Disease

lymphocytic leukemia;GAD

Disease

Asthma;FunDO

Disease

Cancer;FunDO

Disease

HIV infection;FunDO

Disease

Glaucoma;FunDO

Disease

Fanconi's anemia;FunDO

Disease

Emphysema;FunDO

Disease

T-cell acute lymphoblastic leukemia;OMIM

Disease

IMMUNE;GAD

Disease

Cancers of the digestive system;KEGG DISEASE

Disease

Alzheimer's disease;FunDO

Disease

Autoimmune disease;FunDO

Disease

Vaccinia;FunDO

Disease

Adenovirus infection;FunDO

Disease

CANCER;GAD

Disease

Graves' disease;FunDO

Disease

Osteomyelitis;FunDO

Disease

Cancers;KEGG DISEASE

Disease

Dermatitis;FunDO

Disease

Abortion;FunDO

Disease

Gallbladder disease;FunDO

Disease

Thyroid gland disease;FunDO

Disease

Osteomyelitis;GAD

External Links

Links to cell senescence gene database

581

Links to epithelial mesenchymal transition gene database

581

Links to ovarian cancer gene database

581

Links to endometrial cancer gene database

581

Links to iHOP

581

Sequence Information

Nucleotide Sequence

>581 : length: 986
TCACGTGACCCGGGCGCGCTGCGGCCGCCCGCGCGGACCCGGCGAGAGGCGGCGGCGGGA
GCGGCGGTGATGGACGGGTCCGGGGAGCAGCCCAGAGGCGGGGGGCCCACCAGCTCTGAG
CAGATCATGAAGACAGGGGCCCTTTTGCTTCAGGGTTTCATCCAGGATCGAGCAGGGCGA
ATGGGGGGGGAGGCACCCGAGCTGGCCCTGGACCCGGTGCCTCAGGATGCGTCCACCAAG
AAGCTGAGCGAGTGTCTCAAGCGCATCGGGGACGAACTGGACAGTAACATGGAGCTGCAG
AGGATGATTGCCGCCGTGGACACAGACTCCCCCCGAGAGGTCTTTTTCCGAGTGGCAGCT
GACATGTTTTCTGACGGCAACTTCAACTGGGGCCGGGTTGTCGCCCTTTTCTACTTTGCC
AGCAAACTGGTGCTCAAGGCTGGCGTGAAATGGCGTGATCTGGGCTCACTGCAACCTCTG
CCTCCTGGGTTCAAGCGATTCACCTGCCTCAGCATCCCAAGGAGCTGGGATTACAGGCCC
TGTGCACCAAGGTGCCGGAACTGATCAGAACCATCATGGGCTGGACATTGGACTTCCTCC
GGGAGCGGCTGTTGGGCTGGATCCAAGACCAGGGTGGTTGGGACGGCCTCCTCTCCTACT
TTGGGACGCCCACGTGGCAGACCGTGACCATCTTTGTGGCGGGAGTGCTCACCGCCTCAC
TCACCATCTGGAAGAAGATGGGCTGAGGCCCCCAGCTGCCTTGGACTGTGTTTTTCCTCC
ATAAATTATGGCATTTTTCTGGGAGGGGTGGGGATTGGGGGACGTGGGCATTTTTCTTAC
TTTTGTAATTATTGGGGGGTGTGGGGAAGAGTGGTCTTGAGGGGGTAATAAACCTCCTTC
GGGACACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>581 : length: 221
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWGLPLAESLKRLMSLSPGRPPLL
LWDAHVADRDHLCGGSAHRLTHHLEEDGLRPPAALDCVFPP