ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

580

Name

BARD1

Synonym

BRCA1 associated RING domain 1;BARD1;BRCA1 associated RING domain 1

Definition

BRCA1-associated RING domain gene 1|BRCA1-associated RING domain protein 1

Position

2q35

Gene Type

protein-coding

Pathways and Diseases

Pathway

BARD1 signaling events;PID Curated;200174

Pathway

brca1 dependent ub ligase activity;PID BioCarta;100232

Disease

Female reproductive cancer;FunDO

Disease

breast cancer;GAD

Disease

neuroblastoma (high-risk);GAD

Disease

Neuroblastoma (high-risk);NHGRI

Disease

CANCER;GAD

Disease

breast cancer breast cancer, male colorectal cancer ovarian cancer prostate cancer;GAD

Disease

Cancer;FunDO

Disease

Breast cancer, susceptibility to;OMIM

External Links

Links to cell senescence gene database

580

Links to epithelial mesenchymal transition gene database

580

Links to ovarian cancer gene database

580

Links to endometrial cancer gene database

580

Links to iHOP

580

Sequence Information

Nucleotide Sequence

>580 : length: 5586
AATCGGGCTGGGGTGGGGCTGAGGCTTCTGCATTTTTTACCCGGCCCTGGATTACCCCGC
TGCTTTCCGGGAGCTGTGGCGAATTGGGCTGGCGGGCCGCCCCGGAGACCCTCTAAATTA
GAAGCAGCTGCCACTCTAAGTTAAACTGGCCTTTTTGACATTTTCTCCGTGCCAGCTTTT
TCGAGTGAGATGGGATGGAGCATCGGATATCTACCATAGTTGTAGATTGAAGATGGCACG
GAATTTCTCATTTTCTTAGTTTGCTCAAAAGACTGTATGTCTGGTGTCCCCGCTCTTAGT
GATGCTGTTTATTGTTTTCCTTCATGCTGTCACATTATGGGAGTCCTCTCAGGGTTTTCA
TTCCGTCCAAAGACATTTTCTACTAACATTCTGAGAGAGCCTGTGTGTTTAGGAGGATGT
GAGCACATCTTCTGTAGTAATTGTGTAAGTGACTGCATTGGAACTGGATGTCCAGTGTGT
TACACCCCGGCCTGGATACAAGACTTGAAGATAAATAGACAACTGGACAGCATGATTCAA
CTTTGTAGTAAGCTTCGAAATTTGCTACATGACAATGAGCTGTCAGATTTGAAAGAAGAT
AAACCTAGGAAAAGTTTGTTTAATGATGCAGGAAACAAGAAGAATTCAATTAAAATGTGG
TTTAGCCCTCGAAGTAAGAAAGTCAGATATGTTGTGAGTAAAGCTTCAGTGCAAACCCAG
CCTGCAATAAAAAAAGATGCAAGTGCTCAGCAAGACTCATATGAATTTGTTTCCCCAAGT
CCTCCTGCAGATGTTTCTGAGAGGGCTAAAAAGGCTTCTGCAAGATCTGGAAAAAAGCAA
AAAAAGAAAACTTTAGCTGAAATCAACCAAAAATGGAATTTAGAGGCAGAAAAAGAAGAT
GGTGAATTTGACTCCAAAGAGGAATCTAAGCAAAAGCTGGTATCCTTCTGTAGCCAACCA
TCTGTTATCTCCAGTCCTCAGATAAATGGTGAAATAGACTTACTAGCAAGTGGCTCCTTG
ACAGAATCTGAATGTTTTGGAAGTTTAACTGAAGTCTCTTTACCATTGGCTGAGCAAATA
GAGTCTCCAGACACTAAGAGCAGGAATGAAGTAGTGACTCCTGAGAAGGTCTGCAAAAAT
TATCTTACATCTAAGAAATCTTTGCCATTAGAAAATAATGGAAAACGTGGCCATCACAAT
AGACTTTCCAGTCCCATTTCTAAGAGATGTAGAACCAGCATTCTGAGCACCAGTGGAGAT
TTTGTTAAGCAAACGGTGCCCTCAGAAAATATACCATTGCCTGAATGTTCTTCACCACCT
TCATGCAAACGTAAAGTTGGTGGTACATCAGGGAGGAAAAACAGTAACATGTCCGATGAA
TTCATTAGTCTTTCACCAGGTACACCACCTTCTACATTAAGTAGTTCAAGTTACAGGCGA
GTGATGTCTAGTCCCTCAGCAATGAAGCTGTTGCCCAATATGGCTGTGAAAAGAAATCAT
AGAGGAGAGACTTTGCTCCATATTGCTTCTATTAAGGGCGACATACCTTCTGTTGAATAC
CTTTTACAAAATGGAAGTGATCCAAATGTTAAAGACCATGCTGGATGGACACCATTGCAT
GAAGCTTGCAATCATGGGCACCTGAAGGTAGTGGAATTATTGCTCCAGCATAAGGCATTG
GTGAACACCACCGGGTATCAAAATGACTCACCACTTCACGATGCAGCCAAGAATGGGCAT
GTGGATATAGTCAAGCTGTTACTTTCCTATGGAGCCTCCAGAAATGCTGTTAATATATTT
GGTCTGCGGCCTGTCGATTATACAGATGATGAAAGTATGAAATCGCTATTGCTGCTACCA
GAGAAGAATGAATCATCCTCAGCTAGCCACTGCTCAGTAATGAACACTGGGCAGCGTAGG
GATGGACCTCTTGTACTTATAGGCAGTGGGCTGTCTTCAGAACAACAGAAAATGCTCAGT
GAGCTTGCAGTAATTCTTAAGGCTAAAAAATATACTGAGTTTGACAGTACAGTAACTCAT
GTTGTTGTTCCTGGTGATGCAGTTCAAAGTACCTTGAAGTGTATGCTTGGGATTCTCAAT
GGATGCTGGATTCTAAAATTTGAATGGGTAAAAGCATGTCTACGAAGAAAAGTATGTGAA
CAGGAAGAAAAGTATGAAATTCCTGAAGGTCCACGCAGAAGCAGGCTCAACAGAGAACAG
CTGTTGCCAAAGCTGTTTGATGGATGCTACTTCTATTTGTGGGGAACCTTCAAACACCAT
CCAAAGGACAACCTTATTAAGCTCGTCACTGCAGGTGGGGGCCAGATCCTCAGTAGAAAG
CCCAAGCCAGACAGTGACGTGACTCAGACCATCAATACAGTCGCATACCATGCGAGACCC
GATTCTGATCAGCGCTTCTGCACACAGTATATCATCTATGAAGATTTGTGTAATTATCAC
CCAGAGAGGGTTCGGCAGGGCAAAGTCTGGAAGGCTCCTTCGAGCTGGTTTATAGACTGT
GTGATGTCCTTTGAGTTGCTTCCTCTTGACAGCTGAATATTATACCAGATGAACATTTCA
AATTGAATTTGCACGGTTTGTGAGAGCCCAGTCATTGTACTGTTTTTAATGTTCACATTT
TTACAAATAGGTAGAGTCATTCATATTTGTCTTTGAATCAAAAAAAAAAAAAAAGTCTAA
TGCCAGATTAGGAATTCATGTTATGTTTACCATTTAGAAGCTGGGATTGCTTTTAAAGGT
TTTTCTTTTTAAAATTGGCATGTTTTTGATTTATCATGTCTTTCTATTCAGATTATTGGG
TATCAAAGATTAATGAGGACACCAGAATCTTGGTTAAATAGACAAGTGGTATCATTACTG
TTTGAGTCTTTTAATATTCTCCATACCTGCCACCAGTGAAAAAACTTGCCTTTTTTTTTT
TTTTTTTTTTAGTAAACAGAATATTATCAAACAATTTATTTTGGCTTTATTGAAAAAAGA
GTATTTGGTCTAAATGTGCCACCATAGGTGTTAAATTCTCCTATCTGCAATTGTCTTTAT
CCTATATTGTGTTCATTTCTTTTCTTAATAATTTACTTTGTTGTGTGTTTCTACACTTTC
ATCCCTGTTTTTTATCTTGTATATCATCAGGAAATTGTGATTTAATCATTAACATTGGTT
TTTTTGTGTGTGTGGTAAAAATCAACACTAGGCTCATGGTACATATTTTTATTCTGTACA
TTTGCTTGTAACTATCAATTTGTAACTCTGTTTATCTACTACATGTGTATATATACTTAG
AGCATTTTCTCTAACACATTTTAATGTTAGTATTTTTTAAAAGGTCTGACCAGTCTAGCA
AATTGTCAGTCCAACGTCATTACTTTAAATTAAGAAGCAGTCTTCTTCTGGTAAACCTTG
TTGGTATTTGTAAAATAATTTTGAAGGTCTTAATTTCTTCCTTTGTAAAAGGAAAAGGTT
TTTTTTAAAGTTTTTAGGTTGGCATGGAGGCAGAAGTTGGTGATTACTTGATTTACAACA
GATTTTTTCCAGATCATACAAAAGGCCATACAGTAAGTATAGAAGTAGGTATGGGGAGGG
CTTACTAATATCAAATAGGCAAGGCCTTAGTGAGTGGGCAGGATACCACCTGAGAGTGGC
CAGATGTGGGGAGGTTACTCTGCTCTGGGTGCTCTCATTCATGAATCGACAAGGATACAT
TAGATTATTTTGAAACATTTTTTTAAGAAGCAGAATTCTTTAATAATTCCTTCCTAGACA
TTGAATATACTTATAAAATTAAAGACTTGGGGAAGGAGACACTGAGAGACTTGCCAGTTT
GGTTCCTCATGAACAAAAGAGGACAGTTTGATAACTACCAGAATAGAATATCCCTAGTTT
TAAAATAGTGAGAATCTCTGAAGTTCATCAACATCTTAAGATGCACTTACTTGAAAGTTT
GAGATTCTGTTTATCATTTGAAAACACATTTTGCTTTAATTCTTTCTTTGACATGTTGTT
TTTTCATATCAAGAAATATATGAACAAAATAATAACCTTTTGACCCTGACCTTGCTGGGT
GAATTAGCTCTGAAACACTCTCTACAACCAGTAATGCATTTGTCCCACATTTCATTCTGA
TAGAAAATGAACACCATAGCACCAAACAAAAATCCGAGGCGTTAGATAATGTCTGGATTA
AATAATTTAAGACTCTCTAGGATTTTGGTTGTCATTTTTTATTTATAACAGACTTTAAGT
CACTTTCTGTTGCCTCATAGGTCACATTTTAGACAGGTTTGTGTCTGTTCCTTGCATCTG
AATTCCTGATTGTAAAGACACCTATGAGGTCTCTTAGTTTTTGTCATTCATTTTCTTGGT
TTATCACCCCTCCCTTCTTTTTGTTGTTTTTCCCTGACTGTTAAGCAGTTTCATCTTTGC
TTTTGTTAAATATTTGACAGCAGTTAGTTTGTGTTAAGCTCTTGAAACTTGTGATTGTAC
TTTCTGTGTAGATATACATGTAATTATTTTTTATTTTTCAATCATAGATTCAAGCTTCCT
TCTTTTTTACCACAAATCATTAAAGTTATTTGTGTTTCCATATACCTGTGTCTTGTATAA
AATTGGCTTATTCTGTGCTGTTGAATGAGGCTCAACATGACTTGGTGAGGAAGTCTATTA
ACTAACAAAAGCTTATCTTTTTTAACATAATGCTTTTTAATTAATTTTGAATAAAAATAT
TTCTAAAGTGTACTAGATACTTTATTACCTTAGATTATTCCGAATACAGTATAACTTTGA
TAGTTTGGAATAGTCATTAAGAAACAATTACACACTGATTGCTTTGTGTCTCTAAAAGTG
AGAGGCTGGTAGCTTTTCCACATTCTCATGGCTATTTTCTAGTTCTACTTGAATTTATAA
CTGTTTCCCTTTTTCCTTGACAGCTGCCACTTTGTAGCTATTTTTCTGTCTCTGCTAATA
CTTTACCATATCTATCTCAATTGTTTTTTCTTTTGACTTGCTGAAAAATAGAAACCAGAT
GGGAAGTATATTAGCATTATGATTGAAATAAGGGTAAATGAGCAATGTGTGAAGGTTTTC
ACTGACTTCACCTAAAAGATAGTTTAGCTACTTGAATTTTAGTAAATAGAATTTTTCCTT
TATTTCATCGGTCCCCCCACCTTTTTTTTTTTTTGCACCTGCCTTGTAAATTTAATAGTT
AAGTGACCTCTGCCTAGAGGATGATATTTGGGGAGGTTTGATGTTTCCTGTGGGAATAAG
ACGATTCACAGGTGAGAGTGGGGCCACATTAGCTGTTATTGTTTCCATGGGTCAGTGTGG
AAAATGCATTAATCATATTCTAAACGTTCATGGGCCTCATTACAGTCACAATTGTCTATT
CTGTTTCCTACCCTGAACACATTAAAATGGTAGGAACTAATGCTTGTCTTATTTAATTAC
TAAAAGCCACCATTTTCTTTGATAGATTGAGCTACAGATTGTAAACTTCATGTATTTCTT
TATAAGTCAACCCTTTTCAAAGATACGCACATCAAACTGAATGAATAAATAAATATTGAG
AAGTTG

Protein Sequence

>580 : length: 777
MPDNRQPRNRQPRIRSGNEPRSAPAMEPDGRGAWAHSRAALDRLEKLLRCSRCTNILREP
VCLGGCEHIFCSNCVSDCIGTGCPVCYTPAWIQDLKINRQLDSMIQLCSKLRNLLHDNEL
SDLKEDKPRKSLFNDAGNKKNSIKMWFSPRSKKVRYVVSKASVQTQPAIKKDASAQQDSY
EFVSPSPPADVSERAKKASARSGKKQKKKTLAEINQKWNLEAEKEDGEFDSKEESKQKLV
SFCSQPSVISSPQINGEIDLLASGSLTESECFGSLTEVSLPLAEQIESPDTKSRNEVVTP
EKVCKNYLTSKKSLPLENNGKRGHHNRLSSPISKRCRTSILSTSGDFVKQTVPSENIPLP
ECSSPPSCKRKVGGTSGRKNSNMSDEFISLSPGTPPSTLSSSSYRRVMSSPSAMKLLPNM
AVKRNHRGETLLHIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVELL
LQHKALVNTTGYQNDSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYTDDESMK
SLLLLPEKNESSSASHCSVMNTGQRRDGPLVLIGSGLSSEQQKMLSELAVILKAKKYTEF
DSTVTHVVVPGDAVQSTLKCMLGILNGCWILKFEWVKACLRRKVCEQEEKYEIPEGPRRS
RLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTV
AYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWKAPSSWFIDCVMSFELLPLDS