ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5781

Name

PTPN11

Synonym

BPTP3|CFC|NS1|PTP-1D|PTP2C|SH-PTP2|SH-PTP3|SHP2;protein tyrosine phosphatase, non-receptor type 11;PTPN11;protein tyrosine phosphatase, non-receptor type 11

Definition

PTP-2C|protein-tyrosine phosphatase 1D|protein-tyrosine phosphatase 2C|tyrosine-protein phosphatase non-receptor type 11

Position

12q24

Gene Type

protein-coding

Pathways and Diseases

Pathway

Interactions of the immunoglobulin superfamily (IgSF) member proteins;Reactome;REACT:23853

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Signaling events regulated by Ret tyrosine kinase;PID Curated;200058

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

Signaling by Insulin receptor;Reactome;REACT:498

Pathway

igf-1 signaling pathway;PID BioCarta;100136

Pathway

Signaling by FGFR;Reactome;REACT:9470

Pathway

Fc-epsilon receptor I signaling in mast cells;PID Curated;200003

Pathway

Interferon-gamma signaling pathway;PANTHER;P00035

Pathway

insulin signaling pathway;PID BioCarta;100124

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

VEGFR1 specific signals;PID Curated;200151

Pathway

PDGFR-beta signaling pathway;PID Curated;200127

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

CTLA4 inhibitory signaling;PID Reactome;500487

Pathway

IL2 signaling events mediated by STAT5;PID Curated;200158

Pathway

Signaling by PDGF;Reactome;REACT:16888

Pathway

Signaling by EGFR;Reactome;REACT:9417

Pathway

Down-stream signal transduction;PID Reactome;500509

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

EPO signaling pathway;PID Curated;200157

Pathway

EGF receptor (ErbB1) signaling pathway;PID Curated;200085

Pathway

Neurotrophic factor-mediated Trk receptor signaling;PID Curated;200128

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Netrin mediated repulsion signals;PID Reactome;500090

Pathway

cell to cell adhesion signaling;PID BioCarta;100208

Pathway

IL2 signaling events mediated by PI3K;PID Curated;200099

Pathway

Adipocytokine signaling pathway;KEGG PATHWAY;hsa04920

Pathway

ErbB2/ErbB3 signaling events;PID Curated;200119

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

Insulin Pathway;PID Curated;200012

Pathway

TCR signaling in naive CD4+ T cells;PID Curated;200022

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

Cell surface interactions at the vascular wall;PID Reactome;500305

Pathway

Cell junction organization;Reactome;REACT:20676

Pathway

Epithelial cell signaling in Helicobacter pylori infection;KEGG PATHWAY;hsa05120

Pathway

Angiogenesis;PANTHER;P00005

Pathway

IGF1 pathway;PID Curated;200084

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

the co-stimulatory signal during t-cell activation;PID BioCarta;100193

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Pathway

Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066

Pathway

Gab1 signalosome;PID Reactome;500514

Pathway

Hemostasis;Reactome;REACT:604

Pathway

FRS2-mediated cascade;PID Reactome;500248

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

IFN-gamma pathway;PID Curated;200110

Pathway

PECAM1 interactions;PID Reactome;500307

Pathway

il 6 signaling pathway;PID BioCarta;100126

Pathway

IL6-mediated signaling events;PID Curated;200124

Pathway

Signaling events mediated by Stem cell factor receptor (c-Kit);PID Curated;200156

Pathway

Tie2 Signaling;PID Reactome;500306

Pathway

Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650

Pathway

GMCSF-mediated signaling events;PID Curated;200015

Pathway

FGF signaling pathway;PID Curated;200189

Disease

Type 1 diabetes;NHGRI

Disease

gastric atrophy;GAD

Disease

HEMATOLOGICAL;GAD

Disease

Hematological parameters;NHGRI

Disease

Congenital heart disease;FunDO

Disease

Skin disease, Genetic;FunDO

Disease

Leukemia, Myeloid, Acute;GAD

Disease

DEVELOPMENTAL;GAD

Disease

Herpes;FunDO

Disease

heart anomalies, congenital;GAD

Disease

stomach atrophy;GAD

Disease

Leukemia;FunDO

Disease

IMMUNE;GAD

Disease

Infection;FunDO

Disease

Leukemia, juvenile myelomonocytic;OMIM

Disease

hematological parameters;GAD

Disease

METABOLIC;GAD

Disease

Noonan-like/multiple giant cell lesion syndrome;OMIM

Disease

Leopard syndrome;OMIM

Disease

Noonan syndrome;GAD

Disease

Lymphoproliferative disorder;FunDO

Disease

Solid tumor;FunDO

Disease

CARDIOVASCULAR;GAD

Disease

Noonan syndrome 1;OMIM

Disease

CANCER;GAD

Disease

Deafness;FunDO

Disease

plasma HDL cholesterol (HDL-C) levels;GAD

Disease

Brain tumor;FunDO

Disease

Hemorrhagic disorder;FunDO

Disease

Myeloproliferative disease;FunDO

Disease

leukemia;GAD

Disease

type 1 diabetes;GAD

Disease

Skin cancer;FunDO

Disease

stomach cancer;GAD

External Links

Links to cell senescence gene database

5781

Links to epithelial mesenchymal transition gene database

5781

Links to ovarian cancer gene database

5781

Links to endometrial cancer gene database

5781

Links to iHOP

5781

Sequence Information

Nucleotide Sequence

>5781 : length: 6300
CGGCCGCGGTTTCCAGGAGGAAGCAAGGATGCTTTGGACACTGTGCGTGGCGCCTCCGCG
GAGCCCCCGCGCTGCCATTCCCGGCCGTCGCTCGGTCCTCCGCTGACGGGAAGCAGGAAG
TGGCGGCGGGCGTCGCGAGCGGTGACATCACGGGGGCGACGGCGGCGAAGGGCGGGGGCG
GAGGAGGAGCGAGCCGGGCCGGGGGGCAGCTGCACAGTCTCCGGGATCCCCAGGCCTGGA
GGGGGGTCTGTGCGCGGCCGGCTGGCTCTGCCCCGCGTCCGGTCCCGAGCGGGCCTCCCT
CGGGCCAGCCCGATGTGACCGAGCCCAGCGGAGCCTGAGCAAGGAGCGGGTCCGTCGCGG
AGCCGGAGGGCGGGAGGAACATGACATCGCGGAGATGGTTTCACCCAAATATCACTGGTG
TGGAGGCAGAAAACCTACTGTTGACAAGAGGAGTTGATGGCAGTTTTTTGGCAAGGCCTA
GTAAAAGTAACCCTGGAGACTTCACACTTTCCGTTAGAAGAAATGGAGCTGTCACCCACA
TCAAGATTCAGAACACTGGTGATTACTATGACCTGTATGGAGGGGAGAAATTTGCCACTT
TGGCTGAGTTGGTCCAGTATTACATGGAACATCACGGGCAATTAAAAGAGAAGAATGGAG
ATGTCATTGAGCTTAAATATCCTCTGAACTGTGCAGATCCTACCTCTGAAAGGTGGTTTC
ATGGACATCTCTCTGGGAAAGAAGCAGAGAAATTATTAACTGAAAAAGGAAAACATGGTA
GTTTTCTTGTACGAGAGAGCCAGAGCCACCCTGGAGATTTTGTTCTTTCTGTGCGCACTG
GTGATGACAAAGGGGAGAGCAATGACGGCAAGTCTAAAGTGACCCATGTTATGATTCGCT
GTCAGGAACTGAAATACGACGTTGGTGGAGGAGAACGGTTTGATTCTTTGACAGATCTTG
TGGAACATTATAAGAAGAATCCTATGGTGGAAACATTGGGTACAGTACTACAACTCAAGC
AGCCCCTTAACACGACTCGTATAAATGCTGCTGAAATAGAAAGCAGAGTTCGAGAACTAA
GCAAATTAGCTGAGACCACAGATAAAGTCAAACAAGGCTTTTGGGAAGAATTTGAGACAC
TACAACAACAGGAGTGCAAACTTCTCTACAGCCGAAAAGAGGGTCAAAGGCAAGAAAACA
AAAACAAAAATAGATATAAAAACATCCTGCCCTTTGATCATACCAGGGTTGTCCTACACG
ATGGTGATCCCAATGAGCCTGTTTCAGATTACATCAATGCAAATATCATCATGCCTGAAT
TTGAAACCAAGTGCAACAATTCAAAGCCCAAAAAGAGTTACATTGCCACACAAGGCTGCC
TGCAAAACACGGTGAATGACTTTTGGCGGATGGTGTTCCAAGAAAACTCCCGAGTGATTG
TCATGACAACGAAAGAAGTGGAGAGAGGAAAGAGTAAATGTGTCAAATACTGGCCTGATG
AGTATGCTCTAAAAGAATATGGCGTCATGCGTGTTAGGAACGTCAAAGAAAGCGCCGCTC
ATGACTATACGCTAAGAGAACTTAAACTTTCAAAGGTTGGACAAGGGAATACGGAGAGAA
CGGTCTGGCAATACCACTTTCGGACCTGGCCGGACCACGGCGTGCCCAGCGACCCTGGGG
GCGTGCTGGACTTCCTGGAGGAGGTGCACCATAAGCAGGAGAGCATCATGGATGCAGGGC
CGGTCGTGGTGCACTGCAGTGCTGGAATTGGCCGGACAGGGACGTTCATTGTGATTGATA
TTCTTATTGACATCATCAGAGAGAAAGGTGTTGACTGCGATATTGACGTTCCCAAAACCA
TCCAGATGGTGCGGTCTCAGAGGTCAGGGATGGTCCAGACAGAAGCACAGTACCGATTTA
TCTATATGGCGGTCCAGCATTATATTGAAACACTACAGCGCAGGATTGAAGAAGAGCAGA
AAAGCAAGAGGAAAGGGCACGAATATACAAATATTAAGTATTCTCTAGCGGACCAGACGA
GTGGAGATCAGAGCCCTCTCCCGCCTTGTACTCCAACGCCACCCTGTGCAGAAATGAGAG
AAGACAGTGCTAGAGTCTATGAAAACGTGGGCCTGATGCAACAGCAGAAAAGTTTCAGAT
GAGAAAACCTGCCAAAACTTCAGCACAGAAATAGATGTGGACTTTCACCCTCTCCCTAAA
AAGATCAAGAACAGACGCAAGAAAGTTTATGTGAAGACAGAATTTGGATTTGGAAGGCTT
GCAATGTGGTTGACTACCTTTTGATAAGCAAAATTTGAAACCATTTAAAGACCACTGTAT
TTTAACTCAACAATACCTGCTTCCCAATTACTCATTTCCTCAGATAAGAAGAAATCATCT
CTACAATGTAGACAACATTATATTTTATAGAATTTGTTTGAAATTGAGGAAGCAGTTAAA
TTGTGCGCTGTATTTTGCAGATTATGGGGATTCAAATTCTAGTAATAGGCTTTTTTATTT
TTATTTTTATACCCTTAACCAGTTTAATTTTTTTTTTCCTCATTGTTGGGGATGATGAGA
AGAAATGATTTGGGAAAATTAAGTAACAACGACCTAGAAAAGTGAGAACAATCTCATTTA
CCATCATGTATCCAGTAGTGGATAATTCATTTTGATGGCTTCTATTTTTGGCCAAATGAG
AATTAAGCCAGTGCCTGAGACTGTCAGAAGTTGACCTTTGCACTGGCATTAAAGAGTCAT
AGAAAAAGAATCATGGATATTTATGAATTAAGGTAAGAGGTGTGGCTTTTTTTTTTTTCT
TTTTTCCAGCCGTTGACCAATTATAGTTCGGCTGTTGACTGAGAAGTTTGTGGTGGGAAA
ACGTTTGCCATATTTTCTTTGCATTTGAATAATTGTCTTGTACTTAGAAAAAAGGCGTCT
ATGAATGACCAGTGTTTTTGGTCGCCAAATGTTGCTGACAAACTTATCCCAAAACTTTAG
TGGCTTAAAAAAACCTGCCCCCAACTGTTAGTCAATCTGAGCTGGGCTCAGCTGGGCTGT
TCTTCTGCCAGCCTGCAGGTGGCCACTCATGTGGTCAGCAGGTCGGCGGAGAGACTGGGA
TGGCTGGGCTTCTCTCTCTGCCTGCAGTCCTGAGTCTCTCCTTCTTCGTGTAGTCTCTTT
CAGTGGCCTGGCTGGCAGGGTAGCTAGACCTCTCACATGCAGCTCAGAGCTCCCAAGAGC
TCAAAAGCAGAAATGGCCAGGCCTTCTGAAAACTTAAGTCCAGAATTGTCACAGTGTCCC
TTCTACTTCCCTCTATTGATGATGATGATGATGATGATGATGATGATGATGATGATGATG
ATGGTTTTTTCTAATCAGAAGAAAGCTGGGGTATGCCCTCTACTTACTAAACAAGTCACA
AGCCCAGCTCAGATTCAAGAAAAGGGTGTGAAGTAGAGGTGCAGTTAAGTGGGGGGCCAC
TAGTCTAACAGACGGTCACAACCAGTGCCATGGAAAACCAAGGATATTAGCAAAAGCAGA
AGTTGCTAGTGACCTTGGGAAGCCGAAGCTGCTTACAGTAGCTGGGACAAGCTGAAAGTC
AGACTAAGAAATAAAGAGAGGGCCTTCAAGAAGCTTCCTGAATGATTTCTGCTAGCCCTG
AGCCTATTTTTGGAACCAGCACTTGGGGAAACTGATCTTGTGAGGATGGATGTGTTTAGG
GACACAGGGCTTTTGAGAGCAGCACCACCCCACTGGGGCATCCCCAGACTTGGGAAACGT
GACTCTTTCTTAATGCCACTGGGTTTTAGTCAGGCCACAGTGAGAAGGAACAGCCCTAAC
AGGCCTCCAGCCAGGTTGAATGAGCTCATTTTTGTTGTAGCCAACCAGTAAGATTTGCTA
ATGTTCTACATTAAGTGCCTTCTCCAAAGACATCCCTCTTTGCCTCATATGTTGAATCAT
CCAGTGCGGATATTTCAATGAAAATATCATTGGTTGACTTTTGTGATGGTAATAATGCTA
TGGCATCTTTGCCATGAAGTTGTGGCCTCCTTGGATTCTTCTGACTTTGGCTTCTGAAAG
GAAGGCCTAGATCCAGCCCTGGTGGTAGTTCCTTTCTGAGGTCTCTCAGTCCCTTGAGAC
TTTGGGGTAGTTTGGCTGCCATTCTCACTGACAAAATGTATATCAGCCCCCACCTCCACC
CCCCAATATTCCTTGAACTTTGAATTGCTTCAGAACACAGGTGTGGCCTGAAGGTATTCC
CTTATTAGGGAAGTGTCACTGCTGTCTTCTAGTCAAACTTGTAAAGAAAAAGATTCCAGT
TCAGTATTTGCAGCAAGAAGCTTGAATGCTGTTCTTTTTATCGCATTGTTACATCGACTC
ATTCTCCATTTTGCTTTGGTTTTGTCTTGACTTGACTTGACTTTGGGGGTAAAGTCTTTC
ACCAGCACACAAGAGTTTGATTGTACAAATATATCTTCTGCATTAACATCTCTGCCTGTT
GCTTAAGATCAGTTGCTTTTATACTCAGAATGGAAATACCTGATCTTGGCTAGTTTTGTT
ATAAGATATTGATTTCATTTAGATTTCCCTCCACGAGGTCAGCAAACTATCATGTTCTTA
TGTAAACTTAGGCCAAGGCCAGAGTTATCATAGTCCCTAGGTTGCTACGGCTTATCATGT
GCTTGGTAAAAGGTGATCGCAGGTTCTCAGACGAGTTTACTTTACATGAGATGGAATCAG
GCAGAGAGGCTGGGATGATGGAGAAAGCTCGAGGTGAAGTTTTAAAAAAAAAGTTGTGGA
AAGGAAAGTTCCAAAGAGGTGGTTTCTGAGGAAGTCAGAGCGCCCAGGGCCAGAGCAGTC
AGTAATGGGTGAATGAGGTTGTTTGGAAAGTCGGTGTGACAGACACATGGATGCCATCTA
CTTCTAGGTTGCTGGTGGGTATTAAATATGCACAATATTCCATAGCTCACTGAGGATTTT
AAAATTATAAGCATAGGATTTTATATTTTGGGGTGAAAGAATTATCTGGCACATTAGGTA
TTGGAGTTTAAAAAAAAAGCCAAATTTCACAGTCTTAATAACTTTTTTTAAAAAAAACTA
AAAGGCGCTTCATGTCCAGTGTGTGGCCCTTCTGAAACTTATGGTCATCTCTCCCACTGA
AACCAAGGTCTTTTCAAATGTGGCTAAATGGGGATGAGGAGACACGGGTAGGACTTTCTT
GGTGTGTGTGCATTCTTTAAAGAGCCAAGTTGCTTCGGGGAAACAGCCAGGAAAATGGTC
AAGATTATTTTTAGAGGTTATTTTATTGGGGATTTTAAGAACTAATAACATCTTGAGTTA
TTTTTAATTCAGGGGGATGTGGAAAGGTTTGCAATTGTCAAGTGTTTTGTTGTAGCTTAG
TATCCATAAGGGAAACTTAGACTATAGACATAACTACAAAGCCAGTGCAGCTTTTGTTTT
CTGTATGTTGTTGGGGGATCAACTTTCACACATAGCAAGCACATGGCCTCCCTGATGTCA
GGATGCCTTTGTTAGGATCTGTATTTGCCCTTAATTTTGTTGAAATCTTTTTTCCTTCTT
CCTCTTGAAAAGTTCCAAAATATAGTTTATTGTATCTTTCATCACTAAAAATTTGTTCCT
TTTTCACTATGGGCAGTTCACACAAGGCAAAAACTATTGAACAGTTGGTTTTAGTGTGTT
GTATAACTTTGCTGTATATCAAACTAATTTTGACAAGTTTTCATCCTAAGCCTCAAATCA
TGTAATTAATAATTTGCCTGTTTATTTATGACCTAATTGTGATTCTTTTATTAATAAAAG
CTAATGGGAAAAGGATCCCTGATTAAGCTGATGACTAGACCTACAATTAATTTTCCTGCA
GTATATGAAGTATTGTACCAGAGTATTAAAAGATATGTAATATTTTATTGATAAATCTAT
CCTTTAAAAGGAATACGTTTTAGGATGTCATCATTTTGATGTGAATCATGTAAATGTTGA
TAATATGCTGTTTATTATACATTTAGTGTTTCAAGAGATTCACTTAATTGCCTTTTTGCC
CACGTATATTATGTAGTCTATTTGCAACTGTTCTTAAAAAAATGACATTAAAAGAATAGT
TTATGTAGAGAAACATTAGTGGATGTTAATTGTCTCCCCACCTATATTTATGGGTGTTAG
CGCAACTGCTTTGCTAGTTGCAAAGCTGTATTATCAGAGTAAAAGTGTATTTGTAAACTG
TATGGGAACTAAAAATTAGGAATAAAACCATTTTCTTATATGAAAAAAAAAAAAAAAAAA

Protein Sequence

>5781 : length: 597
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQALLQGNTERTVW
QYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILI
DIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSK
RKGHEYTNIKYSLADQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQKSFR