ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5757

Name

PTMA

Synonym

TMSA;prothymosin, alpha;PTMA;prothymosin, alpha

Definition

gene sequence 28|prothymosin alpha|prothymosin alpha protein

Position

2q37.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Disease

Adenocarcinoma;FunDO

Disease

DEVELOPMENTAL;GAD

Disease

height;GAD

Disease

Prostate cancer;FunDO

External Links

Links to cell senescence gene database

5757

Links to epithelial mesenchymal transition gene database

5757

Links to ovarian cancer gene database

5757

Links to endometrial cancer gene database

5757

Links to iHOP

5757

Sequence Information

Nucleotide Sequence

>5757 : length: 2672
CTCGGGCGGTGTTTGGCGCGCAGCAGCTGGACTGTCTCAAGCCCGCTGTTGCTCCCTCTC
GCGGGGAAACGGCCCGCCCCCGGCGCGGTGCCCTCAGGCAGCCCACTCTTTGTGTGGTGC
GGGGGAGGGGGCGGGAACCGCCGCGGGCAGACGTGATGCCCGTCGGGGAGTGGGCCGGGC
GCCCTCGGGGGCCGAGGGCTAGGCGCGGAGGCCGGCTCACGGCCCTCGAAACTCGTCTGT
GGCCGGTATGAGTGGCGGCGGGAGGAGAAGAGCCTGGCTGGGGGTCGTCGGCCCGCCGGG
CGCACGGAAATAACTTTGAAACTCAAGCGCGTTGGGAATCGGAAGTGCTGGGGGGCGCGT
GTTGGGGCGCGGGCCGGCCGCGGGAAGTGGCGGCGAGCGCCCGCCGGCCGCGCTGCTCTT
TGTTCGGCGCCAGGCCGGCGGTTTCGCGCCCTGCAGCGGACCTGAGGTGGTTTGTCTAGA
CTAAGTCCCGATAAGGCGGATGGGGCGACGGGCTGGCTGGCCGCGACGTCGGCCGTCCCG
GCGGAGGTGTGACGGGCTTATCCGCTTTGGGCGCTCTGGGAGGCGGGGGTGGGCGCCCTT
CGAGGTGAGTGCGCCGGGAGCGGCCGCCCAGCTTCAGTCATGCACCCGCGGTGCCGGGCT
TGGCTGAGGAGGCGAGAGCCCACGCGCCGCAGGGAGGAAAGAGAAAGTGAAGCGCGGCGC
TGGGGCGACGATGGGCGCCCCCCGCGGCTGCCCGGGAGCACCGTGTGCGCCGCAGCTCGG
GGCGACGCGGGCCAACACGGCGGCCGCGACAGGCCAATGGTAGGGTCGAACTGGGGGGGC
GCCCGGGCCCCGTGGCGGGTTCACTGCCCTCGGCTATGAGGTCCTGCGCGGCTGGTGCGG
CTCCGCTCCTGTTGTCGGCGCCGCCTCGGTCCCACTGCCCGCCCTGGGTAGCGTCTCCGC
CCTTGGCGGGAGCGGGGCGCTCTCAGACTGACTGGCTCTTTCTTAATATTTCGGCCCTCG
TCCGCGCCCGTCGTGCCCCTGCAGGGATTGGCGCGAGTCACCTTGGCGTCTCCTTAACCC
TTGTGTCCCTGGCGTCATCTCTGACTCTCCCAGGGGCGACTTCTTGGCAGAGCGGAGCTC
GGGGCCCGGATCTCCACAGGGGCTCTCAGTGACCCCTTCTGGACTCAGTCCGGGAATGAG
TTTGTGGGGTGAGAACACCGTCCCCAGTGCGGGGCCTGGCTGTTCGATTTTCTCCGAAGC
ACCAAAAGGTGACTTCCCGCGAGGGCGATGAGTAGTAGCCCGAGAGGCGCATCCCCGACA
GTCTCGGACCTACGCAGCCCGGTGGACTTTGGGGCGACCTCCCGTGGGACTTGGCCCGCC
GAATGCAGACATTCGGGCCTGCCGGGGTGGCGGCAGTGGGGCGTCGAGTCGAGAGCCCGG
CCGACCGACGCGCGACCCGCGCGCGTGCCACTGCAAGCTCTGCCTGCCGGCCGGGAGTCT
CCAAGGCAAGGGACGCACTCGGCGGCCCCGGGCCACGTGCTCCCTGCGCGCGGTGCGTGC
CGAGGCCCGCGCGCAAAGCCCGCCGGGCGGGGGATGCGCGCCTGCGCGCCGCGACCTCCC
TGCCCCCACTGCTCCCCGGGGCTTCGGCCGCCAGGGGGCGAGAGCGGGCGGAGCCGGGGT
CCGCGGAGCGGAGCGGGGCGGGCCGGACTGAGAGGGCCGACAGGTGGCCCGGAGCCGCTC
GCCGGACAGCGGCCGAGGGGTTCCCGCAGGCCCGGACGCCGGACCTCTGACTTAAAGGAG
AAGAAGGAAGTTGTGGAAGAGGCAGAAAATGGAAGAGACGCCCCTGCTAACGGGAATGCT
GTGAGGAAGAGGATGGAGATGAAGATGAGGAAGCTGAGTCAGCTACGGGCAAGCGGGCAG
CTGAAGATGATGAGGATGACGATGTCGATACCAAGAAGCAGAAGACCGACGAGGATGACT
AGACAGCAAAAAAGGAAAAGTTAAACTAAAAAAAAAAAGGCCGCCGTGACCTATTCACCC
TCCACTTCCCGTCTCAGAATCTAAACGTGGTCACCTTCGAGTAGAGAGGCCCGCCCGCCC
ACCGTGGGCAGTGCCACCCGCAGATGACACGCGCTCTCCACCACCCAACCCAAACCATGA
GAATTTGCAACAGGGGAGGAAAAAAGAACCAAAACTTCCAAGGCCCTGCTTTTTTTCTTA
AAAGTACTTTAAAAAGGAAATTTGTTTGTATTTTTTATTTACATTTTATATTTTTGTACA
TATTGTTAGGGTCAGCCATTTTTAATGATCTCGGATGACCAAACCAGCCTTCGGAGCGTT
CTCTGTCCTACTTCTGACTTTACTTGTGGTGTGACCATGTTCATTATAATCTCAAAGGAG
AAAAAAAACCTTGTAAAAAAAGCAAAAATGACAACAGAAAAACAATCTTATTCCGAGCAT
TCCAGTAACTTTTTTGTGTATGTACTTAGCTGTACTATAAGTAGTTGGTTTGTATGAGAT
GGTTAAAAAGGCCAAAGATAAAAGGTTTCTTTTTTTTTCCTTTTTTGTCTATGAAGTTGC
TGTTTATTTTTTTTGGCCTGTTTGATGTATGTGTGAAACAATGTTGTCCAACAATAAACA
GGAATTTTATTTTGCTGAGTTGTTCTAACAAA

Protein Sequence

>5757 : length: 263
MSSSPRGASPTVSDLRSPVDFGATSRGTWPAECRHSGLPGWRQWGVESRARPTDARPARV
PLQALPAGRESPRQGTHSAAPGHVLPARGACRGPRAKPAGRGMRACAPRPPCPHCSPGLR
PPGGESGRSRGPRSGAGRAGLRGPTGGPEPLAGQRPRGSRRPGRRTSDLKEKKEVVEEAE
NGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATG
KRAAEDDEDDDVDTKKQKTDEDD