ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5754

Name

PTK7

Synonym

CCK-4|CCK4;protein tyrosine kinase 7 (inactive);PTK7;protein tyrosine kinase 7 (inactive)

Definition

PTK7 protein tyrosine kinase 7|colon carcinoma kinase 4|inactive tyrosine-protein kinase 7|pseudo tyrosine kinase receptor 7|tyrosine-protein kinase-like 7

Position

6p21.1-p12.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

5754

Links to epithelial mesenchymal transition gene database

5754

Links to ovarian cancer gene database

5754

Links to endometrial cancer gene database

5754

Links to iHOP

5754

Sequence Information

Nucleotide Sequence

>5754 : length: 4273
GGCGGGGCTTGGCGGCGGCGGCGGCGGCGCGCGGGGACTCGGAGGTACTGGGCGCGCGCG
GCTCCGGCTCGGGACGCCTCGGGACGCCTCGGGGTCGGGCTCCGGCTGCGGCTGCTGCTG
CGGCGCCCGCGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCCGCGGAGCGCAGTCTGCGCG
CCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCGCGATGGGAGCTGCGCGGGGAT
CCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCG
GTACCCAGACAGCCATTGTCTTCATCAAGCAGCCGTCCTCCCAGGATGCACTGCAGGGGC
GCCGGGCGCTGCTTCGCTGTGAGGTTGAGGCTCCGGGCCCGGTACATGTGTACTGGCTGC
TCGATGGGGCCCCTGTCCAGGACACGGAGCGGCGTTTCGCCCAGGGCAGCAGCCTGAGCT
TTGCAGCTGTGGACCGGCTGCAGGACTCTGGCACCTTCCAGTGTGTGGCTCGGGATGATG
TCACTGGAGAAGAAGCCCGCAGTGCCAACGCCTCCTTCAACATCAAATGGATTGAGGCAG
GTCCTGTGGTCCTGAAGCATCCAGCCTCGGAAGCTGAGATCCAGCCACAGACCCAGGTCA
CACTTCGTTGCCACATTGATGGGCACCCTCGGCCCACCTACCAATGGTTCCGAGATGGGA
CCCCCCTTTCTGATGGTCAGAGCAACCACACAGTCAGCAGCAAGGAGCGGAACCTGACGC
TCCGGCCAGCTGGTCCTGAGCATAGTGGGCTGTATTCCTGCTGCGCCCACAGTGCTTTTG
GCCAGGCTTGCAGCAGCCAGAACTTCACCTTGAGCATTGCTGATGAAAGCTTTGCCAGGG
TGGTGCTGGCACCCCAGGACGTGGTAGTAGCGAGGTATGAGGAGGCCATGTTCCATTGCC
AGTTCTCAGCCCAGCCACCCCCGAGCCTGCAGTGGCTCTTTGAGGATGAGACTCCCATCA
CTAACCGCAGTCGCCCCCCACACCTCCGCAGAGCCACAGTGTTTGCCAACGGGTCTCTGC
TGCTGACCCAGGTCCGGCCACGCAATGCAGGGATCTACCGCTGCATTGGCCAGGGGCAGA
GGGGCCCACCCATCATCCTGGAAGCCACACTTCACCTAGCAGAGATTGAAGACATGCCGC
TATTTGAGCCACGGGTGTTTACAGCTGGCAGCGAGGAGCGTGTGACCTGCCTTCCCCCCA
AGGGTCTGCCAGAGCCCAGCGTGTGGTGGGAGCACGCGGGAGTCCGGCTGCCCACCCATG
GCAGGGTCTACCAGAAGGGCCACGAGCTGGTGTTGGCCAATATTGCTGAAAGTGATGCTG
GTGTCTACACCTGCCACGCGGCCAACCTGGCTGGTCAGCGGAGACAGGATGTCAACATCA
CTGTGGCCACTGTGCCCTCCTGGCTGAAGAAGCCCCAAGACAGCCAGCTGGAGGAGGGCA
AACCCGGCTACTTGGATTGCCTGACCCAGGCCACACCAAAACCTACAGTTGTCTGGTACA
GAAACCAGATGCTCATCTCAGAGGACTCACGGTTCGAGGTCTTCAAGAATGGGACCTTGC
GCATCAACAGCGTGGAGGTGTATGATGGGACATGGTACCGTTGTATGAGCAGCACCCCAG
CCGGCAGCATCGAGGCGCAAGCCCGTGTCCAAGTGCTGGAAAAGCTCAAGTTCACACCAC
CACCCCAGCCACAGCAGTGCATGGAGTTTGACAAGGAGGCCACGGTGCCCTGTTCAGCCA
CAGGCCGAGAGAAGCCCACTATTAAGTGGGAACGGGCAGATGGGAGCAGCCTCCCAGAGT
GGGTGACAGACAACGCTGGGACCCTGCATTTTGCCCGGGTGACTCGAGATGACGCTGGCA
ACTACACTTGCATTGCCTCCAACGGGCCGCAGGGCCAGATTCGTGCCCATGTCCAGCTCA
CTGTGGCAGTTTTTATCACCTTCAAAGTGGAACCAGAGCGTACGACTGTGTACCAGGGCC
ACACAGCCCTACTGCAGTGCGAGGCCCAGGGGGACCCCAAGCCGCTGATTCAGTGGAAAG
GCAAGGACCGCATCCTGGACCCCACCAAGCTGGGACCCAGGATGCACATCTTCCAGAATG
GCTCCCTGGTGATCCATGACGTGGCCCCTGAGGACTCAGGCCGCTACACCTGCATTGCAG
GCAACAGCTGCAACATCAAGCACACGGAGGCCCCCCTCTATGTCGTGGACAAGCCTGTGC
CGGAGGAGTCGGAGGGCCCTGGCAGCCCTCCCCCCTACAAGATGATCCAGACCATTGGGT
TGTCGGTGGGTGCCGCTGTGGCCTACATCATTGCCGTGCTGGGCCTCATGTTCTACTGCA
AGAAGCGCTGCAAAGCCAAGCGGCTGCAGAAGCAGCCCGAGGGCGAGGAGCCAGAGATGG
AATGCCTCAACGGTGGGCCTTTGCAGAACGGGCAGCCCTCAGCAGAGATCCAAGAAGAAG
TGGCCTTGACCAGCTTGGGCTCCGGCCCCGCGGCCACCAACAAACGCCACAGCACAAGTG
ATAAGATGCACTTCCCACGGTCTAGCCTGCAGCCCATCACCACGCTGGGGAAGAGTGAGT
TTGGGGAGGTGTTCCTGGCAAAGGCTCAGGGCTTGGAGGAGGGAGTGGCAGAGACCCTGG
TACTTGTGAAGAGCCTGCAGAGCAAGGATGAGCAGCAGCAGCTGGACTTCCGGAGGGAGT
TGGAGATGTTTGGGAAGCTGAACCACGCCAACGTGGTGCGGCTCCTGGGGCTGTGCCGGG
AGGCTGAGCCCCACTACATGGTGCTGGAATATGTGGATCTGGGAGACCTCAAGCAGTTCC
TGAGGATTTCCAAGAGCAAGGATGAAAAATTGAAGTCACAGCCCCTCAGCACCAAGCAGA
AGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAACCGCTTTG
TGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGT
CTGCCCTGGGCCTCAGCAAGGATGTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCT
GGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCTACCAAGT
CTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCC
ATGGTGGGCAGGCAGATGATGAAGTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTC
CTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGGGCCCTCA
GCCCCAAGGACCGGCCCTCCTTCAGTGAGATTGCCAGCGCCCTGGGAGACAGCACCGTGG
ACAGCAAGCCGTGAGGAGGGAGCCCGCTCAGGATGGCCTGGGCAGGGGAGGACATCTCTA
GAGGGAAGCTCACAGCATGATGGGCAAGATCCCTGTCCTCCTGGGCCCTGAGGCCCCTGC
CCTAGTGCAACAGGCATTGCTGAGGTCTGAGCAGGGCCTGGCCTTTCCTCCTCTTCCTCA
CCCTCATCCTTTGGGAGGCTGACTTGGACCCAAACTGGGCGACTAGGGCTTTGAGCTGGG
CAGTTTTCCCTGCCACCTCTTCCTCTATCAGGGACAGTGTGGGTGCCACAGGTAACCCCA
ATTTCTGGCCTTCAACTTCTCCCCTTGACCGGGTCCAACTCTGCCACTCATCTGCCAACT
TTGCCTGGGGAGGGCTAGGCTTGGGATGAGCTGGGTTTGTGGGGAGTTCCTTAATATTCT
CAAGTTCTGGGCACACAGGGTTAATGAGTCTCTTGGCCCACTGGTCCCACTTGGGGGTCT
AGACCAGGATTATAGAGGACACAGCAAGTGAGTCCTCCCCACTCTGGGCTTGTGCACACT
GACCCAGACCCACGTCTTCCCCACCCTTCTCTCCTTTCCTCATCCTAAGTGCCTGGCAGA
TGAAGGAGTTTTCAGGAGCTTTTGACACTATATAAACCGCCCTTTTTGTATGCACCACGG
GCGGCTTTTATATGTAATTGCAGCGTGGGGTGGGTGGGCATGGGAGGTAGGGGTGGGCCC
TGGAGATGAGGAGGGTGGGCCATCCTTACCCCACACTTTTATTGTTGTCGTTTTTTGTTT
GTTTTGTTTTTTTGTTTTTGTTTTTGTTTTTACACTCGCTGCTCTCAATAAATAAGCCTT
TTTTACAACCTGT

Protein Sequence

>5754 : length: 1078
MGSFLSGEKRPSAPTVGSAMEKKEFPTPPGRVGPGTQTAIVFIKQPSSQDALQGRRALLR
CEVEAPGPVHVYWLLDGAPVQDTERRFAQGSSLSFAAVDRLQDSGTFQCVARDDVTGEEA
RSANASFNIKWIEAGPVVLKHPASEAEIQPQTQVTLRCHIDGHPRPTYQWFRDGTPLSDG
QSNHTVSSKERNLTLRPAGPEHSGLYSCCAHSAFGQACSSQNFTLSIADESFARVVLAPQ
DVVVARYEEAMFHCQFSAQPPPSLQWLFEDETPITNRSRPPHLRRATVFANGSLLLTQVR
PRNAGIYRCIGQGQRGPPIILEATLHLAEIEDMPLFEPRVFTAGSEERVTCLPPKGLPEP
SVWWEHAGVRLPTHGRVYQKGHELVLANIAESDAGVYTCHAANLAGQRRQDVNITVATVP
SWLKKPQDSQLEEGKPGYLDCLTQATPKPTVVWYRNQMLISEDSRFEVFKNGTLRINSVE
VYDGTWYRCMSSTPAGSIEAQARVQVLEKLKFTPPPQPQQCMEFDKEATVPCSATGREKP
TIKWERADGSSLPEWVTDNAGTLHFARVTRDDAGNYTCIASNGPQGQIRAHVQLTVAVFI
TFKVEPERTTVYQGHTALLQCEAQGDPKPLIQWKGKDRILDPTKLGPRMHIFQNGSLVIH
DVAPEDSGRYTCIAGNSCNIKHTEAPLYVVDKPVPEESEGPGSPPPYKMIQTIGLSVGAA
VAYIIAVLGLMFYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPSAEIQEEVALTSL
GSGPAATNKRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLVLVKSL
QSKDEQQQLDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKS
KDEKLKSQPLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLS
KDVYNSEYYHFRQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQAD
DEVLADLQAGKARLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDSTVDSKP