ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

57508

Name

INTS2

Synonym

INT2|KIAA1287;integrator complex subunit 2;INTS2;integrator complex subunit 2

Definition

-

Position

17q23.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

57508

Links to epithelial mesenchymal transition gene database

57508

Links to ovarian cancer gene database

57508

Links to endometrial cancer gene database

57508

Links to iHOP

57508

Sequence Information

Nucleotide Sequence

>57508 : length: 6162
CTCTGCCTTTCCTCTCGCAGCCACCCTTCCTCTCAGACCAGTACGGTGGCCGACGGGAGT
CAGACGCTGGGGATGAATGAAGGTGCTGGGTGCAGGTTGAAAAAGTCTCCCGCTTTTCCG
TTCCTACAGTCCCGGTTCTGCCTTTGTGTGGTGCCCCCATCCTTCCCACTTTGTATCGAC
AACCCGGTTGGTCCCGGCGTCTGAGTTCTTGGTGTCCGAGTCGACTCGAGGCACAACTAG
GGTTTGGGGTTCCGGATATCGCCTAGGCCCAACATCGGACCGCGCTCTCGATTTCTGCCG
CGTCCCGCCTCTAGGACGCGGAGTCCGTGTGCGGTTCCGTGAGGCTGGAGGGTAGATCTT
AAGGATCAACAAACAGTAATAATGACTGAATGTACAAGTCTTCAGTTTGTCAGCCCTTTT
GCTTTTGAGGCAATGCAGAAGGTGGATGTTGTTTGCCTGGCATCTTTAAGTGATCCAGAA
TTAAGACTTCTTCTGCCCTGTTTGGTACGGATGGCACTTTGTGCACCTGCTGACCAGAGC
CAAAGCTGGGCTCAGGATAAGAAACTCATCCTTCGCCTTCTTTCTGGAGTGGAAGCTGTC
AACTCCATTGTTGCATTGTTGTCCGTGGACTTTCATGCTTTAGAACAAGATGCCAGCAAA
GAACAGCAGCTTAGGCATAAACTTGGAGGAGGCAGTGGAGAGAGCATCCTGGTATCACAG
CTTCAGCATGGACTGACGTTAGAGTTTGAACACAGTGATTCACCTCGTCGATTGCGTCTT
GTGCTTAGTGAACTGTTGGCAATTATGAACAAGGTGTCTGAGTCCAACGGAGAATTTTTT
TTCAAGTCTTCTGAACTTTTTGAGAGTCCAGTATATTTGGAGGAAGCTGCAGATGTACTT
TGTATTTTACAAGCAGAGCTCCCTTCCTTGCTCCCTATAGTTGATGTAGCTGAAGCTTTG
CTACATGTTAGAAATGGTGCCTGGTTCTTGTGTCTCTTGGTGGCCAATGTTCCTGATAGT
TTTAATGAAGTTTGTAGGGGCCTGATAAAAAATGGAGAACGACAAGATGAAGAAAGTCTT
GGAGGAAGGCGCAGGACAGATGCCTTACGCTTCTTGTGTAAAATGAATCCTTCTCAGGCC
CTCAAGGTCCGAGGCATGGTGGTGGAAGAATGTCACTTGCCAGGCCTTGGTGTGGCTTTG
ACATTGGATCATACTAAAAATGAAGCTTGTGAGGATGGAGTGAGTGACTTGGTTTGTTTT
GTAAGTGGTTTGCTTCTTGGAACAAATGCGAAAGTCCGGACTTGGTTTGGAACTTTTATC
CGAAATGGACAGCAGAGAAAAAGAGAGACCAGCAGTTCTGTCCTTTGGCAGATGAGAAGG
CAGCTTCTTCTGGAGTTGATGGGCATTCTTCCCACAGTAAGAAGCACCCGAATTGTGGAA
GAAGCTGATGTGGATATGGAGCCCAATGTGTCTGTGTATTCGGGGCTGAAAGAAGAGCAT
GTTGTGAAAGCCAGTGCACTCTTACGTCTGTACTGTGCTTTGATGGGGATCGCTGGACTC
AAACCAACTGAAGAAGAAGCTGAGCAATTACTGCAGTTGATGACGAGCCGTCCTCCTGCT
ACGCCAGCTGGGGTTCGCTTTGTTTCACTTTCCTTTTGTATGCTACTGGCCTTTTCTACA
CTTGTCAGTACACCTGAACAGGAGCAGCTGATGGTGGTGTGGCTAAGTTGGATGATAAAA
GAAGAAGCGTATTTTGAGAGTACTTCAGGCGTCTCTGCTTCTTTTGGGGAGATGTTATTA
TTGGTGGCTATGTACTTTCACAGCAACCAGCTTAGTGCTATCATTGACTTGGTCTGTTCC
ACTTTGGGGATGAAGATTGTAATTAAGCCAAGCTCCTTGAGCAGGATGAAGACAATCTTC
ACACAGGAAATTTTTACTGAGCAGGTTGTCACAGCTCATGCAGTTCGGGTCCCTGTCACC
AGCAACCTGAGTGCCAACATTACTGGATTTTTGCCTATTCATTGTATTTACCAGCTTCTC
AGGAGCCGTTCCTTTACCAAGCACAAAGTGTCAATAAAAGATTGGATTTATAGACAGCTG
TGTGAAACCTCTACTCCACTTCATCCTCAATTACTTCCTTTGATTGATGTGTACATAAAT
TCTATACTTACTCCTGCGTCGAAATCTAATCCAGAAGCCACAAATCAGCCAGTCACAGAA
CAGGAGATACTCAATATTTTCCAAGGAGTCATTGGGGGTGACAACATCCGCCTTAATCAG
CGTTTCAGTATCACAGCACAGCTTTTGGTGCTCTACTATATACTGTCTTATGAAGAGGCT
CTTCTAGCAAACACGAAGACTTTAGCTGCCATGCAAAGAAAGCCCAAATCATATTCTTCT
TCTTTAATGGATCAGATTCCTATCAAATTCCTTATTCGACAGGCTCAAGGGCTGCAGCAG
GAGTTGGGAGGGTTGCATTCAGCTTTACTACGTCTCCTTGCTACTAACTACCCACATTTA
TGTATTGTGGATGACTGGATTTGTGAAGAAGAAATCACAGGGACTGATGCCCTGCTACGG
CGAATGCTCCTGACTAATAATGCTAAAAATCATTCTCCCAAACAACTCCAAGAAGCATTT
TCAGCTGTCCCAGTAAATCACACACAAGTGATGCAGATTATAGAACACTTGACTCTACTC
TCTGCCAGTGAACTTATACCATATGCGGAAGTGTTAACATCCAATATGAGCCAGCTATTG
AATTCAGGGGTTCCACGGAGAATTCTGCAAACAGTCAATAAACTATGGATGGTTCTTAAT
ACTGTGATGCCTAGAAGGCTATGGGTAATGACGGTTAATGCACTTCAGCCTTCAATAAAG
TTTGTACGACAACAAAAGTATACTCAGAATGACCTGATGATAGATCCTCTCATTGTCCTA
AGGTGTGATCAGAGGGTTCACAGATGCCCCCCACTGATGGATATTACCCTACACATGTTG
AATGGATATCTTCTTGCATCTAAAGCCTACCTTAGTGCTCATCTGAAGGAAACAGAGCAA
GATAGGCCTTCCCAGAATAATACAATTGGTTTAGTTGGACAAACTGATGCTCCGGAAGTT
ACCAGGGAAGAATTGAAAAATGCATTACTGGCCGCTCAGGATAGTGCAGCTGTCCAGATT
CTCTTAGAGATTTGCCTACCTACTGAAGAGGAGAAAGCAAATGGTGTCAATCCAGATAGC
TTGTTAAGAAATGTTCAAAGTGTTATTACCACCAGCGCTCCAAATAAGGGAATGGAGGAA
GGAGAAGACAATTTGCTCTGTAACCTTCGAGAAGTTCAGTGCCTTATCTGTTGTCTCTTG
CACCAAATGTACATTGCAGATCCCAACATTGCTAAGCTTGTTCACTTTCAGGGTTATCCA
TGTGAACTTTTGCCTCTGACGGTCGCAGGTATTCCATCTATGCACATCTGTCTAGATTTC
ATACCTGAGCTTATTGCACAGCCAGAACTTGAGAAACAGATATTTGCTATCCAGTTGCTT
TCTCACTTGTGTATACAATATGCATTACCAAAGTCACTTAGTGTGGCTCGTTTAGCTGTC
AATGTCATGGGAACTTTGTTAACAGTTTTAACACAGGCTAAGCGGTATGCTTTTTTTATG
CCAACTCTGCCAAGTTTGGTCTCTTTTTGTCGAGCATTTCCTCCATTGTATGAGGATATT
ATGTCTTTGCTGATCCAAATAGGGCAAGTTTGTGCCTCTGATGTTGCCACTCAGACAAGA
GACATTGATCCAATTATTACACGTCTTCAACAAATAAAGGAGAAACCAAGTGGATGGTCT
CAAATCTGTAAAGATTCATCTTATAAAAATGGATCCAGGGACACTGGAAGCATGGATCCT
GATGTACAGCTCTGTCACTGTATTGAAAGAACAGTAATTGAAATAATAAATATGAGTGTT
AGTGGAATTTAAAACAAAATTTAAAACAACAAAAAGTTGTTTGCTGCATATACCCAACAT
GAATCTGCATATTAGTAACAACTCTAAACTGAATGGGAACAGTAAAGTATTGTCTTGGAA
TCACTAAAACAATTCAATTCAACATGAGTATAGTTTAGAACTTTATGAGAATTATGCTTG
CTTGTTTCTGATTGGCACATCTTTGGATCTACTTTGCTGATATGTTTCTATTGTAGCAGC
TGAGCTTTTTTTTTTTCCACTGGGAACACATGTAAGAAACTCATTATTGGAAAGGGAATT
TGGCCTTGTATTTAGCTTTTGAAGTGAAGACTGCCATGCCTTTAATTTCTTATAAAAATG
AGTCTGTGGGTAGCCCTAGTGTTTATTTTAACTGTGAGCTTGTAACAGAATGTGACAAAG
ATGCAAAGATGGGAGAGGAAAAAAGGGTAAAGGGAAAGGAGAATTAAGGAAATAATAGGA
GTTAAAAACACAAGTAGAAATCTCAAAGATTTGCAGTGCAAGTAATAGTAATGCAAGTTG
GAATTCTAGTTCTCAAGAAAGAGTATTGAGAAGACTTTTAAAAAGGCAAGTAGCTTTTGT
AAATGATTTCTGTGGAAATACAGATGAGGATTTAAAGATTTCACATATTTGCTTCAATTT
TTATTAATATATGAAGCCATATGTTTAAAGAGATACTTGAATAATTTGGAATTTTAAGAT
ACTGGTGTAAAAGTGTTTACAGAAACATCTTTGTTCAAAGAAGAACCTGAGAGATCTCAT
TTAGTTTTATGTTTTAAATTTATTTTTATAATGCTTTATTAACTTACCTAATGCTCAGAG
GGGGGAAATATGTATCAAATTAAATGAAGGTAGAGCAATAAAACCCACTGGATTAAAGAG
CTCTTGGTTTGTCATCAGGATTATAATTCATATCTTACTTTGAGAAGATCTTTGAGTAAG
AAAATGCAGTGTTTGAACCTGAGGAAAAGTTAAAGTGTAGAAAATATTGTCTTGCCGAAG
GATTTTGCAGTCCTCTGTCAGTAACTTCCATTGATTAGGCAGACATATTCAGGTAAACCC
TAATCATTAAAAAAAAATTATCAATGTAGAAAGTAATTCCCTTTTTTCTCTCTGAGATAT
ACCTCAATCACACACTTCCCCACCCCCACTTGAAACAGACCTCTTCACTTGTGTTTTTTT
TTTTTTTTTCCTGAGGTGGAGTCTTCCCCTGTTGCCCAGGCTGGAGTGCAGTGGGATGAT
CTTGGCTCACTGCAACTTCTGCCACCTGGGTTCAAGGGATTCTCGTGCCTCAACCTCCTG
AGTAGCTGGGACTGCAGGCACGCGCCACCTGTATTTTTGTATTTTTAGTAAAGACGGGGG
TTTGCCATGTTGCCCAGACTGGTTTTGAACTCCTGGCCTCAGGTGATCTGCCCACCTTGG
CCTCCCAAAGTGCTGGGATTACAGGTGTGAGCCACCGCACCTGGCCAGACCGCTTCACTT
GTAAAAGAAATTAGGCTAATAAGAAGGTGTAGTTTTTGAGAAATGAAATTTAACTTTAGC
CTTTTCACTAGTAAATAGTCACATCTCATTTTCTTCCTTTGTAAAATGGGGTTACTACTG
GCCCTACCTCATATTCTATGAGAATGAGTTTGTAGCTGTTTCAAATCATGAAGTGCATAG
TATCACATGTGATAGAATATTTATAACTTTTTATTAGATGCTTAATGTTCAATTAAGTAA
TTTTGATGTGAAAAATAAAAGTAATAAAAGTATCTTAAAAATAGCATAAGAATTTTCATA
TTTTTAAACAAGGCAGTTTTGTAGTCCCTTAAGATTAAATACAACTGCTCCTTTTTTTTT
TAAACTGAGGCCTTGCGATATTTTGTGTGAATAGATATGCCCTAGGAGTTCAGAAAAAGT
TAAAAGTATGTTTTCTAATTAAATGCAGTGCACATTCCTGGATCAATATTCAAAGACTGG
TCATAACCTGCTGTGTTAAAATAATCACATATGCTCTTTTTCATCAGATTTGTTGATGAT
GTAAATAAAATGTGTAAATATATTAGTAAATGTTAATATTCATGTATTTTAAGTTAAGGT
TATAAAATTTGTCACAATGTGTTTTTTTATTCAAGTGAAAACAGATGTGTGCAGCTATTT
TGAATATTGGTTTATAAACATTCATATTCTTTATCAAACGAA

Protein Sequence

>57508 : length: 1204
MKDQQTVIMTECTSLQFVSPFAFEAMQKVDVVCLASLSDPELRLLLPCLVRMALCAPADQ
SQSWAQDKKLILRLLSGVEAVNSIVALLSVDFHALEQDASKEQQLRHKLGGGSGESILVS
QLQHGLTLEFEHSDSPRRLRLVLSELLAIMNKVSESNGEFFFKSSELFESPVYLEEAADV
LCILQAELPSLLPIVDVAEALLHVRNGAWFLCLLVANVPDSFNEVCRGLIKNGERQDEES
LGGRRRTDALRFLCKMNPSQALKVRGMVVEECHLPGLGVALTLDHTKNEACEDGVSDLVC
FVSGLLLGTNAKVRTWFGTFIRNGQQRKRETSSSVLWQMRRQLLLELMGILPTVRSTRIV
EEADVDMEPNVSVYSGLKEEHVVKASALLRLYCALMGIAGLKPTEEEAEQLLQLMTSRPP
ATPAGVRFVSLSFCMLLAFSTLVSTPEQEQLMVVWLSWMIKEEAYFESTSGVSASFGEML
LLVAMYFHSNQLSAIIDLVCSTLGMKIVIKPSSLSRMKTIFTQEIFTEQVVTAHAVRVPV
TSNLSANITGFLPIHCIYQLLRSRSFTKHKVSIKDWIYRQLCETSTPLHPQLLPLIDVYI
NSILTPASKSNPEATNQPVTEQEILNIFQGVIGGDNIRLNQRFSITAQLLVLYYILSYEE
ALLANTKTLAAMQRKPKSYSSSLMDQIPIKFLIRQAQGLQQELGGLHSALLRLLATNYPH
LCIVDDWICEEEITGTDALLRRMLLTNNAKNHSPKQLQEAFSAVPVNHTQVMQIIEHLTL
LSASELIPYAEVLTSNMSQLLNSGVPRRILQTVNKLWMVLNTVMPRRLWVMTVNALQPSI
KFVRQQKYTQNDLMIDPLIVLRCDQRVHRCPPLMDITLHMLNGYLLASKAYLSAHLKETE
QDRPSQNNTIGLVGQTDAPEVTREELKNALLAAQDSAAVQILLEICLPTEEEKANGVNPD
SLLRNVQSVITTSAPNKGMEEGEDNLLCNLREVQCLICCLLHQMYIADPNIAKLVHFQGY
PCELLPLTVAGIPSMHICLDFIPELIAQPELEKQIFAIQLLSHLCIQYALPKSLSVARLA
VNVMGTLLTVLTQAKRYAFFMPTLPSLVSFCRAFPPLYEDIMSLLIQIGQVCASDVATQT
RDIDPIITRLQQIKEKPSGWSQICKDSSYKNGSRDTGSMDPDVQLCHCIERTVIEIINMS
VSGI