ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

57496

Name

MKL2

Synonym

MRTF-B|MRTFB|NPD001;MKL/myocardin-like 2;MKL2;MKL/myocardin-like 2

Definition

MKL/myocardin-like protein 2|megakaryoblastic leukemia 2|myocardin-related transcription factor B

Position

16p13.12

Gene Type

protein-coding

External Links

Links to cell senescence gene database

57496

Links to epithelial mesenchymal transition gene database

57496

Links to ovarian cancer gene database

57496

Links to endometrial cancer gene database

57496

Links to iHOP

57496

Sequence Information

Nucleotide Sequence

>57496 : length: 9124
GTGGACTTGTGCTTTGCGTCTTAAAGTGTGGTGCCCACACCATCAGCACGTCAGCAGCAT
CCTGGAGCTTGTTTGAAATGTAGACTCTGAGCTCCACTCCAGACCAACTGGACCAGAATT
TGCATTTTAAAAGATCCCTTCCTGGGCAATGCACGTGAACATATAAAAATCACGGGACCA
GATCTGTGGCTGTCAAACTTGAGTTCACAATAAAGGTGCTAAGAAAGAGAATGTAAGACA
GGAAAATAATTAAATATTCTTACCGAGATCACTCCTGTAAACTCTCACAAGAGATGTTTA
TAAAACACTTGGAACAATACAGATTGTACTAAGAAAATGTGCTTTGATCAACTGTGGAGA
TACAAAGCAGGAAACTTAATAAATCAAGTCCTATTTGTGAATGGAAAGGACTGGAAGTTC
ACCTTAAAATGTCTTCAATAGGCCGTGTTTAAGAGGCGTCTTACACTCCCTGTTGCCAGT
GGCTGGAACACAATGGATCACACAGGGGCGATAGACACCGAGGATGAAGTGGGACCTTTA
GCCCATCTTGCTCCAAGTCCTCAGAGTGAAGCTGTGGCTCATGAATTCCAGGAACTCTCC
TTGCAGTCCAGTCAAAACTTACCCCCTCTGAACGAAAGGAAAAATGTGCTCCAGCTGAGG
CTGCAACAAAGGAGGACGAGAGAACAACTAGTGGACCAGGGCATCATGCCACCTTTGAAG
AGCCCAGCGGCATTCCATGAACAGATAAAAAGCTTGGAACGAGCCAGAACTGAAAACTTT
TTGAAACACAAGATTCGGAGTCGACCAGATCGTTCTGAACTTGTCAGGATGCACATTTTA
GAAGAAACATTTGCAGAGCCATCCCTGCAGGCTACTCAGATGAAGTTGAAAAGAGCTCGA
CTAGCAGATGATCTGAATGAAAAGATTGCTCAAAGACCTGGTCCTATGGAGCTGGTAGAG
AAAAACATCCTTCCTGTGGACTCCAGTGTTAAAGAAGCAATTATAGGCGTTGGGAAGGAG
GACTATCCCCACACTCAGGGCGATTTCTCATTTGATGAAGACAGCAGTGACGCTTTGTCT
CCGGACCAGCCTGCGAGTCAGGAGTCACAGGGGTCAGCCGCGTCCCCAAGTGAGCCAAAA
GTTAGTGAATCGCCATCTCCTGTGACTACAAACACTCCAGCGCAGTTTGCTTCAGTGTCC
CCAACAGTTCCTGAATTCTTGAAAACTCCTCCAACTGCAGATCAGCCTCCCCCACGGCCT
GCAGCTCCTGTCCTCCCCACAAACACTGTGTCCTCAGCAAAGCCTGGCCCAGCACTGGTG
AAGCAAAGCCATCCCAAGAATCCAAATGACAAACACCGTAGCAAAAAGTGCAAAGATCCC
AAACCACGGGTAAAGAAGTTAAAGTACCACCAATACATTCCACCAGATCAGAAGGGTGAG
AAGAATGAGCCGCAGATGGACTCTAACTACGCCCGCCTGCTCCAGCAGCAGCAGCTGTTC
CTGCAACTGCAGATCCTGAGTCAGCAGAAGCAGCACTACAACTACCAGACCATCCTGCCT
GCACCATTCAAGCCACTCAATGACAAAAATAGTAACAGTGGGAATTCAGCTTTGAACAAT
GCCACACCTAACACACCAAGACAGAATACATCTACTCCTGTGAGAAAGCCAGGACCTCTG
CCTTCTAGCCTGGATGACTTAAAGGTATCAGAACTGAAGACAGAACTGAAGTTAAGGGGT
CTGCCAGTGTCAGGCACCAAACCGGACCTCATTGAGCGCCTAAAACCCTACCAGGAAGTG
AACAGCAGCGGCCTTGCTGCTGGGGGCATCGTGGCAGTGTCATCATCAGCCATTGTCACC
AGTAACCCAGAAGTCACTGTGGCCTTGCCGGTTACAACACTACACAACACTGTGACTAGC
TCAGTCTCTACTCTCAAGGCAGAATTGCCACCTACAGGAACCAGCAACGCAACCCGTGTG
GAAAATGTTCATTCCCCTCTGCCCATTTCACCATCTCCCTCCGAACAGTCCAGTCTCAGT
ACTGATGACACAAACATGGCAGACACTTTCACCGAGATTATGACCATGATGTCGCCTTCA
CAGTTCTTGAGTTCATCTCCTTTGAGAATGACAAATAATGAAGACAGTCTGAGTCCCACC
AGCAGCACTCTGTCAAACCTGGAACTGGATGCAGCCGAAAAGGATCGCAAGCTTCAGGAG
AAAGAGAAGCAAATCGAAGAGCTGAAGAGGAAACTGGAACAAGAGCAGAAGCTCGTGGAA
GTGCTGAAAATGCAACTTGAGGTTGAAAAACGAGGGCAGCAGCAGCGGCCCCTGGAAGCC
CAGCCCAGTGCCCCAGGTCATTCTGTCAAGTCAGATCAGAAGCACGGCAGCCTTGGCTCC
TCCATCAAAGATGAGGCCTCACTCCCTGACTGCTCCAGCTCCAGGCAGCCCATCCCAGTA
GCCAGCCACGCTGTAGGCCAGCCCGTCTCTACAGGTGGCCAGACCCTTGTTGCCAAAAAG
GCTGTAGTTATCAAGCAAGAGGTCCCTGTGGGCCAGGCAGAGCAGCAGAGTGTCGTCTCG
CAGTTTTATGTGAGTTCCCAGGGACAGCCACCGCCTGCTGTTGTTGCTCAGCCCCAGGCT
TTACTGACCACGCAGACTGCTCAGCTGCTGCTCCCAGTGTCCATCCAGGGCTCGAGTGTC
ACCTCAGTGCAACTCCCTGTAGGCAGCCTCAAACTCCAGACTTCACCACAAGCAGGAATG
CAGACTCAGCCTCAGATAGCAACTGCTGCACAAATACCAACTGCTGCCTTGGCCTCAGGC
TTGGCCCCAACTGTACCTCAGACACAAGACACGTTCCCGCAGCATGTGCTCAGTCAGCCT
CAACAAGTCAGAAAGGTTTTCACAAACTCAGCATCATCAAATACAGTTCTTCCATATCAG
AGACATCCTGCCCCAGCTGTCCAGCAGCCCTTTATCAATAAGGCCTCCAACAGTGTTCTT
CAATCCAGAAATGCTCCGCTTCCATCCCTGCAAAATGGACCTAACACACCCAACAAGCCT
AGTTCACCCCCGCCACCCCAGCAATTTGTCGTCCAGCACTCTCTATTTGGGAGTCCAGTC
GCCAAGACAAAAGATCCCCCCCGCTATGAGGAGGCCATCAAGCAGACACGCAGCACACAG
GCCCCTCTGCCAGAGATTTCCAACGCTCACAGTCAGCAGATGGATGACCTCTTTGATATC
CTCATTAAGAGTGGAGAGATCTCCCTCCCCATAAAAGAAGAACCTTCTCCTATTTCCAAA
ATGAGACCAGTGACAGCCAGCATCACCACAATGCCAGTGAATACAGTGGTGTCCCGGCCA
CCACCCCAAGTCCAAATGGCACCACCTGTATCTTTAGAACCTATGGGCAGTTTATCTGCC
AGCTTAGAGAACCAACTAGAAGCTTTCTTGGATGGAACTTTACCCTCAGCCAATGAAATT
CCTCCACTACAAAGCAGCAGTGAAGACAGAGAGCCCTTCTCTCTGATCGAGGACCTCCAG
AATGATCTGCTGAGTCACTCAGGTATGCTGGACCATTCACACTCACCCATGGAGACTTCC
GAGACCCAGTTTGCTGCAGGTACTCCCTGTCTGTCTCTCGACCTGTCAGACTCAAACTTG
GACAACATGGAGTGGTTGGACATTACCATGCCCAACTCCTCTTCAGGACTCACTCCTCTC
AGCACCACCGCGCCGAGCATGTTCTCTGCTGACTTTCTAGACCCACAGGACCTACCGCTG
CCATGGGACTAACGTCACAGATTTCTTTTCTGAGAGTTGATGAGGTTTAAGAACATGAAG
ATTCTAAAAGGTCAGTTTTTAGAGATAGATCTATAGTTGCATTGTTGCAATCAAAATATG
TTGTCACAGAAAGAATAGGTGGAAGGTCATAGCCTGGAACCCAAGTTTGAAAACATTTCA
TTGTGTTCAGTAGTGAATTTCTACAGTTTAACATAGCACAGGGCCTTCTGAAAATCGCAC
TTGTCAAAGACGACTCATCTATTTCTCCAGACTTCAGTAAAGAATGAAAAGTACCTTTAG
ATAAAAACAAAGAAGAGTAATATATGCAGCACAGTGACGTTAGGATTCTGGTAATTAACT
ACATTTAAATCTCTGGTCACTTTAAGACCCTAAATAAAAGGCAGACAGCTCCACTCAAAA
ACTAAGGCTGATGTGAGGGAGGTGAGAGGTCACTGCACTTGGTACTTCCTAGAGACGGCC
GGAGCCAGGCCCAAGACACAGCAGAGGTCAAAGGCAGTGGAGAGCCTTGGCCAGTTCAGT
GACAGCTTCTGGCTGAAGACTTTTGGTTCTATTCAGAAACCTGTGTCGTTTTTTTGGTGT
TGTAGTTTATTTTGTGATTTTTTGGAATCGTACTTTATATTTCCAAATTTAAATTTAAAT
GCAAGATCTTTCAACATAAACAGAAGATACCTACAAAATACTGTCAGAAGTCCAGGTATA
CTGATAACACTGAAAATTCTATTAGCAACCTTCTGGGTTGGTTAGATTGATTTTAATGTA
TATATTAGACATTTGTATGTATGCTCTGACATTGTGATTTGTACAGCCTACGCTGGGGTA
AGGAAATGGGTATCCAAGGTCCTACTTTTTTAATAGCTCGAATATTTCTAGAGTACTTGA
GCCACATGTATTTCTGTATTTAAAGAATTGCTGACTAACTTTCAGGTAACCAGACCCATC
TCAAAGAACCAAGAAAAGGCTTTAGCATGAAATATCTTTCTGAGCTGGCGAGTTAGAAGA
ATGGAAGGTAAGGGGAAGGTCTGTCATCTACCCAGGACATTCCCATGATGAGTACAGGTC
AGATTGTGCCACAAGGTGGGCCTCCACGTCCCTGCCCTGGCCCTCTTTCTTCTGTCACTA
ACCCTGGTTATCATTTTACAGGCTTGTAACTGGATATTCTACCAGAGCTCTCACTATATT
GTCAAGCCTAAGATTGAAAAACTGGAGGCTTTATTAGTGTTTTTATATAGAAAACAGTTA
TTACATATGTGTTAAGTCATTTCTTAAGAATTTTCTAAAATGCCAACTATCACAGGATTA
TTTCAAGCTAGTCATTGAGGTATATGACAAAATGTAAATAACAAAAAACTGAAATCTACC
AAAAGAGCATGGAGATTTTTCTTAAATAATAATATTGTGCTCTCCACCTCACCCTTGTGT
AAACCCTCAGGTCAGGTTGGTTCCCCTGGGTCACAAAATGGTAAATGTTCCATACTGACA
TGCCGGAGGCAGCCTGACCCGTTATTTGGAAAGAATTTGTGAATTATTTCTGGGTTTGTG
TTTTGCCTAAGAGCTGATCTTATTTCTGATTTGTGTGTGTGTGGTTTATAAATTTTACTA
CGTGTAACAAAAGTCTGCTTTTCCAGCATGAGCACACTGGAGCCCTCTGCTCACTGGCAC
TTCCTGACTCAAAGGCACTAACAGTGCTCATGTGCCTTCCAGACGGTTCAAGGCAGAGGC
CACTGTGCTCAGTGTAGTCTGTGATGAATAGTTTAAGTGTTCAGAAATTGGTAAACCAAC
ACACGGGATACAATAACTCTCTGTTAACCAGAACACCGTCATTTGACCAAGCCCTACAAG
AGTTTACCACACTAGATGTTCTGTGAATCCTCGAGTCAGTTCCATTGAGAGGGGCCTGTC
TCCAGGGCCAGGCTATTTACTTGGGAAAGTATTTTTCTTACAGTTCTTGGCCACAGTTTT
TTTGCTGAGGGTTTCTGTCTGGGCCTATCAGGTCCATACTTAGACCCTGAGCATCTTCTT
CATTCAGATTTGAATGGCTTATTAAATTAGCACCAAATATCAGTGGGACTGTAGAAGGTA
ACCGAACACTAGTACCATTGACTCTCGTTGAATAACTTTATATTTCCATAATCCTGAATT
GTGTAGATAGTTTTCTAGCTCTCGGGTCCCTTTATTGCTTTTTAAAATAGGGTTTGAAAC
ATGCCACAGGAAGGTTGCTCTCCAAAAATACACAGTGCAGTGCAAGAAAATGCTATCTCA
TTGGCCTACTCTCCTATGAATTGCTAAAGTGCCCACTTCACATATGTGTTTAAACCTTTA
TAAACCAGTATTTCACTTTTAAAAAGACAAGGCATCTCTACCCATTAACTCTGCAAGCCA
CTCCACTTGCACCATTCCGCTTGACCCTCCTCTCTCCTGGCTTGGGTCACCAGCCAGGCA
CCTGTGACACGAGTGCTGCTCTCCAGGATCTCCACTACATGTTCCAGGTTGGAGTGAGGA
CGCGCTATGTGCTCACACTCATGTGACATGACCAAAGATGATACTCTGTAAACAAGGCCC
TTCTGACCGGACTCAGTGCGTGTGATGGTGAGTGCAATGAGGAAGGGTGGATATTGACTA
AAGACTGGTTGTTGTTGTTGTTTAGGTTAGTGTCACAGCCATTACAGCACAAGTCAAAGT
CGCCAGTTGAATTTTCATTATGCACGTGTGTGGTTTAAGCAGTGGTACTGTTGTATATCA
TATTGTAAAGTATCATACTGCCAAGAAAATAACTCCTAGAAAGGCATTATCTCACATCCC
CATCTTACTTTCCTACATGTTCTCAAAACACAGTAGTACCAGCCTTACCTTTCTGCTGTA
TGTAGATAGTCAGATCATCCTACTGGGGGTGGGATGAATTTAAAAGTTATACCAAAATTT
CTGTAAAGTCTTTGAAAGTCTAGGAGTAGGTGGTCATCTTGTACATTTCAGCAAAGCATC
CACTAGGAAACCTCATAGGACAGTGTTAGTGGTTCACGTTCTAGTGTTTTTCCTGAAATG
TGCAATCTACTGTATAGTATTGCCACATAATTGTACATAGATGTATTCTGAATTTGTGGA
ATTTCTTGCTTAGATACTATTGTGTTTGTTTCATATGAATATTTTTGTAATTCTAAAAGA
GATCTTATTTAAATTTCCTTTTTAAAAGCCGCATGGTTCTGTGATCCATGTAACTGACAC
TTTTTGGCTTTCAGTGCTGTTTAGAAACAGTGGCAAAGGCAGGGTGGTGCTGCCTGCAAG
CTGCTGCCTATGGAAGGCAAAGTCATAGTAATGAGATAGCACCTCTGAACTGTGCAGTCA
GCATACCCTGAGTGATGGCTCAGGGGCGCACTACCTATTTTGTCACCAGAGCTGACTCAG
GCTTCCTGGACCCTCAACCCCAGATCATTCCAGGCAGCATAGCTTTCTTCACAGTCCTTT
CAGAATTCCCAGGCTGAAATCAGCCATAGCAGTTGACAAAACAGCTATCCCCACAAGTGA
TGAGATAGTCCCTTTACTGTCCTCAAATGGACTTGGCCTTAGAGACGTGGTAAAGCACTT
TGGCAGGGTTTAAAATATTTGTGAGAAGCCCACATTTCAGTATACATCCTCACTGGCTTC
CATGCACCCACCTGACGGTAGCCTCACAGAAGTCCTGGCTGTCACTCAGGTGGGGAGCTC
ATGGTGCCGCTGGGGACTTTTTAGAGAAATGTAAAGAGAATAGCTATTCAGTGTCTACTA
GCAGAGCAACATGTGTCAATTTAACCAAATTCACAAATAACCCTCCATTTTTCAATATCT
GCTACTGTAAACATGAATATTGAATACTGACAAGAGAATACCCATACAAATCGTCCCACC
GCCCTAGAGGCCACAGAATTAGCCCAAAATTATCAAAGAACATTAACTGGAAGGTCAGGT
TTTTCAAGGAACATAGCTTACAAATGCATCAGTGTGTATCTGGAGAGCATCCTAACTGCA
TTTCAACTCATCTTTTAAGTGATTTCAGTCAAAACTGGAAAACAACTAAGATGTAGTAAT
TTTTTTTTCCTGGTTCAAACCTTCAATAACTTGCTCATTCAGCAGTCTCTCTGAGCTACA
TTTTTATTTGTAAAGTGACTCTGTCTGCATGGCAATGAGCAGGTGCGTGTTTTTTCCACA
TTCGCCCTTTCTTGCAGTATCCAGGGAAACACATCATTACAAAGGGTTTCTACCTGAAAT
CTTTCATGGAAGGCCTACAATTCGAAAAGCTGCACATGTTTACAGAAGAGCTCTTACCCT
CCATGCAAACACTTTGCTCTGTGGTGTCACAGCTTTGTGACAATAAGATGGCAATCTCGG
ATCTACAAGGTGCTGTCGGGAATCAAATAAAATATGTTATCAGAGATATCATCACATCTA
TAGTGTTTAACAGAGCTTTATGCCAACTACTAAGACAAAGCTTTAACAAAGTTTATAGAA
TACTGAAACTCGTAACAATTACCTCTCTACGTGATGCTGTAAGGAATCTTGCTAATTTGG
TAGGAAGAGGAAGCATTTAGGAAAGGGTTTAGTATCTACCAAAAGTACTTGACCTCAAGT
AACCAATAGTAATGCAAACTTGCTTTAAAGGAACCAAAGGCATTGCCAAGTATTTGCCAA
AAGGAGGCACTTTTTATTTAAAATTTGAGACTAATGAGATCTCAAAAATCAGCCCCAAAA
AGGTATTATCCATTTAAGGTTATAATTTTCACTAAGATGTAGATATTTCTCTTATTGTTT
TCATGTAAAATAGTATAGAGTTGTTTTGTTGGTTTAAGAGTAACATTCAGTAGTAATACA
AAGTTTTTTTTCTATGTAGAAATTAGTTTTCTTTTCTTGCTTGCAATAGAAATGCAATGT
GATAGGTGTTTCTCTTCTTATTTTCATTGTCACATTATGTCTTAGCATCTCACTTTATGA
AAAAAAGGAGAAAGATACCAATCTACAGAGCCCTGCTTGTTGAAGCACTAGTTTAATCAA
CAAAAAATTATGGCAATCGGGGGTCCATTCATCTATTGCCTTTATGTTGTTTTTTAAAAG
AAAAACCATGATGCCTTTGTATTTGCTGTTTGCACCCCTGAAATCAATTCCATATCATGT
TTGAATGCCATACATTTTGCACATGTACTGTACATAAGTAATGCATACTGTATTTTTATA
TGTGTGCACATTTATCATCAGATCTTTTGTACATAGTGGCAGTATTGTAGCTGATCGGGA
AATGTTTGATATCTCAGCAATTTTGCATTTTTGTGTCTCAAATAAAAGACATTTTGATGT
ACTA

Protein Sequence

>57496 : length: 1099
MDHTGAIDTEDEVGPLAHLAPSPQSEAVAHEFQELSLQSSQNLPPLNERKNVLQLRLQQR
RTREQLVDQGIMPPLKSPAAFHEQIKSLERARTENFLKHKIRSRPDRSELVRMHILEETF
AEPSLQATQMKLKRARLADDLNEKIAQRPGPMELVEKNILPVDSSVKEAIIGVGKEDYPH
TQGDFSFDEDSSDALSPDQPASQESQGSAASPSEPKVSESPSPVTTNTPAQFASVSPTVP
EFLKTPPTADQPPPRPAAPVLPTNTVSSAKPGPALVKQSHPKNPNDKHRSKKCKDPKPRV
KKLKYHQYIPPDQKGEKNEPQMDSNYARLLQQQQLFLQLQILSQQKQHYNYQTILPAPFK
PLNDKNSNSGNSALNNATPNTPRQNTSTPVRKPGPLPSSLDDLKVSELKTELKLRGLPVS
GTKPDLIERLKPYQEVNSSGLAAGGIVAVSSSAIVTSNPEVTVALPVTTLHNTVTSSVST
LKAELPPTGTSNATRVENVHSPLPISPSPSEQSSLSTDDTNMADTFTEIMTMMSPSQFLS
SSPLRMTNNEDSLSPTSSTLSNLELDAAEKDRKLQEKEKQIEELKRKLEQEQKLVEVLKM
QLEVEKRGQQQRPLEAQPSAPGHSVKSDQKHGSLGSSIKDEASLPDCSSSRQPIPVASHA
VGQPVSTGGQTLVAKKAVVIKQEVPVGQAEQQSVVSQFYVSSQGQPPPAVVAQPQALLTT
QTAQLLLPVSIQGSSVTSVQLPVGSLKLQTSPQAGMQTQPQIATAAQIPTAALASGLAPT
VPQTQDTFPQHVLSQPQQVRKVFTNSASSNTVLPYQRHPAPAVQQPFINKASNSVLQSRN
APLPSLQNGPNTPNKPSSPPPPQQFVVQHSLFGSPVAKTKDPPRYEEAIKQTRSTQAPLP
EISNAHSQQMDDLFDILIKSGEISLPIKEEPSPISKMRPVTASITTMPVNTVVSRPPPQV
QMAPPVSLEPMGSLSASLENQLEAFLDGTLPSANEIPPLQSSSEDREPFSLIEDLQNDLL
SHSGMLDHSHSPMETSETQFAAGTPCLSLDLSDSNLDNMEWLDITMPNSSSGLTPLSTTA
PSMFSADFLDPQDLPLPWD