ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

57468

Name

SLC12A5

Synonym

KCC2;solute carrier family 12 (potassium/chloride transporter), member 5;SLC12A5;solute carrier family 12 (potassium/chloride transporter), member 5

Definition

K-Cl cotransporter 2|electroneutral potassium-chloride cotransporter 2|erythroid K-Cl cotransporter 2|hKCC2|neuronal K-Cl cotransporter|solute carrier family 12 member 5

Position

20q13.12

Gene Type

protein-coding

Pathways and Diseases

Pathway

Transmembrane transport of small molecules;Reactome;REACT:15518

External Links

Links to cell senescence gene database

57468

Links to epithelial mesenchymal transition gene database

57468

Links to ovarian cancer gene database

57468

Links to endometrial cancer gene database

57468

Links to iHOP

57468

Sequence Information

Nucleotide Sequence

>57468 : length: 6084
GTGTGCGAGTGTGTGTGCGCCGGGCGGGCGGGCACTGCAGCTTCTTCCTCCGTGGAGCGG
AGAGCGAGACAGAGCTACAGCGAACGAGAGAGCGGCGAAGGCGGGTAGAGGGGCGCGGGC
GAGGCGGCGCAGCCATCCCCGGACCAGGGGCCGCGCCGCCACCATGCTAAACAACCTGAC
GGACTGCGAGGACGGCGATGGGGGAGCCAACCCGGGTGATGGCAACCCCAAGGAAAGCAG
TCCCTTCATCAACAGCACCGACACAGAGAAGGGAAAGGAGTATGATGGCAAGAACATGGC
CTTGTTTGAGGAGGAGATGGACACCAGCCCTATGGTGTCCTCCTTGCTCAGTGGCCTGGC
CAACTACACCAACCTGCCCCAGGGAAGTAGGGAGCATGAAGAGGCAGAAAACAATGAGGG
TGGAAAAAAGAAGCCGGTGCAGGCCCCACGCATGGGCACCTTCATGGGCGTGTACCTGCC
GTGCCTGCAGAACATCTTTGGCGTCATCCTCTTCCTGCGGCTCACCTGGGTGGTGGGCAT
TGCAGGCATCATGGAGTCCTTCTGCATGGTGTTCATCTGCTGCTCCTGTACGATGCTCAC
GGCCATCTCCATGAGTGCAATTGCAACGAATGGTGTTGTGCCTGCTGGTGGCTCCTACTA
CATGATTTCCAGGTCTCTGGGCCCAGAGTTTGGGGGTGCCGTGGGCCTCTGCTTCTACCT
GGGCACTACCTTTGCAGGAGCCATGTACATCCTGGGCACCATCGAAATCCTGCTGGCTTA
CCTCTTCCCAGCCATGGCCATCTTCAAGGCAGAAGATGCCAGTGGGGAGGCAGCAGCCAT
GCTGAACAACATGCGTGTTTACGGCACCTGTGTGCTCACCTGCATGGCCACTGTGGTGTT
TGTGGGTGTCAAGTATGTCAACAAGTTTGCCCTTGTCTTCCTGGGTTGTGTCATCCTCTC
CATCCTGGCCATCTATGCTGGGGTCATCAAGTCTGCCTTCGACCCACCCAACTTCCCGAT
CTGCCTCCTGGGTAACCGCACGCTGTCTCGCCATGGCTTTGATGTCTGTGCCAAGCTGGC
TTGGGAAGGAAATGAGACGGTGACCACACGGCTATGGGGCCTTTTCTGCTCCTCTCGCTT
CCTCAACGCCACCTGTGATGAATACTTCACCCGAAACAATGTCACAGAGATCCAGGGCAT
CCCTGGTGCTGCCAGTGGCCTCATCAAAGAGAACCTCTGGAGCTCCTACCTGACCAAGGG
CGTGATTGTGGAGAGGAGTGGGATGACCTCGGTGGGCCTGGCCGATGGCACTCCTATCGA
CATGGACCACCCTTATGTCTTCAGTGATATGACCTCCTACTTCACCCTGCTGGTTGGCAT
CTACTTCCCCTCAGTCACAGGGATCATGGCTGGTTCTAACCGCTCTGGGGACCTGAGGGA
TGCCCAGAAGTCAATCCCCACTGGCACCATCCTGGCCATCGCCACCACCTCTGCTGTCTA
CATCAGCTCCGTTGTTCTGTTTGGGGCCTGCATTGAGGGGGTCGTCCTGCGGGACAAGTT
TGGCGAAGCTGTGAATGGCAACCTCGTGGTGGGCACTCTGGCCTGGCCATCTCCATGGGT
AATTGTCATCGGATCCTTCTTCTCCACCTGTGGGGCTGGGCTGCAGAGCCTCACGGGGGC
CCCACGCCTGCTGCAGGCCATCTCGAGGGATGGCATTGTGCCCTTCCTGCAGGTCTTTGG
CCATGGCAAGGCCAATGGAGAGCCGACCTGGGCCCTGCTCCTGACTGCCTGCATCTGCGA
GATTGGCATCCTCATTGCATCCCTCGACGAGGTGGCCCCCATCCTCTCTATGTTCTTCCT
GATGTGCTACATGTTTGTGAATCTGGCCTGTGCAGTGCAGACGCTGCTGAGGACACCCAA
CTGGAGGCCACGCTTTCGATATTACCACTGGACCCTCTCCTTCCTGGGCATGAGCCTCTG
CCTGGCCCTCATGTTCATCTGCTCCTGGTATTATGCACTGGTAGCCATGCTCATTGCTGG
ACTCATCTACAAGTACATTGAGTACCGTGGGGCAGAGAAGGAGTGGGGCGATGGGATACG
AGGTCTGTCTCTCAGTGCGGCTCGCTATGCCCTCTTACGCCTGGAGGAAGGGCCCCCACA
CACCAAGAACTGGAGGCCACAGCTGCTGGTGCTGGTGCGTGTGGACCAAGACCAGAATGT
GGTGCACCCCCAGCTGCTCTCACTGACCTCCCAGCTGAAGGCAGGGAAGGGCCTGACCAT
CGTGGGCTCTGTCCTTGAGGGCACCTTTCTGGAAAATCATCCACAGGCCCAGCGGGCAGA
AGAGTCTATCAGGCGCCTGATGGAGGCAGAGAAGGTGAAGGGCTTCTGCCAGGTGGTGAT
CTCCTCCAACTTGCGTGATGGCGTGTCCCATCTGATCCAGTCCGGGGGCCTCGGGGGGCT
GCAGCACAACACTGTGCTTGTTGGCTGGCCCCGCAACTGGCGCCAGAAGGAAGATCATCA
GACGTGGAGGAACTTCATTGAGCTGGTCCGGGAAACCACAGCTGGCCACTTAGCCCTGCT
GGTCACCAAGAACGTTTCCATGTTTCCTGGGAACCCTGAGCGCTTCTCTGAGGGCAGCAT
CGACGTTTGGTGGATTGTGCACGATGGAGGCATGCTCATGCTGCTGCCCTTCCTGCTGCG
GCACCACAAGGTCTGGCGGAAGTGCAAGATGCGTATCTTCACTGTGGCCCAGATGGATGA
CAATAGCATCCAGATGAAGAAGGATCTGACCACATTTCTGTATCATTTACGCATCACTGC
GGAGGTCGAGGTGGTGGAGATGCATGAGAGCGACATCTCAGCTTACACCTATGAGAAGAC
GTTGGTGATGGAGCAGCGTTCCCAGATCCTCAAACAGATGCATTTAACCAAGAATGAGCG
GGAGCGGGAGATCCAGAGTATCACAGATGAGTCACGAGGCTCAATCCGGAGAAAGAATCC
AGCCAACACGCGGCTCCGCCTGAACGTCCCAGAAGAGACGGCTGGTGACAGTGAAGAGAA
GCCAGAGGAGGAGGTGCAGCTGATCCACGATCAGAGTGCTCCCAGCTGCCCCAGCAGCTC
CCCGTCCCCAGGGGAGGAGCCTGAGGGGGAAGGGGAGACAGATCCGGAGAAGGTGCATCT
CACCTGGACCAAGGACAAGTCGGTGGCAGAGAAGAATAAGGGCCCCAGTCCTGTCTCCTC
TGAGGGCATCAAGGACTTCTTCAGCATGAAGCCGGAGTGGGAGAACTTGAACCAGTCCAA
CGTGCGGCGCATGCACACGGCCGTGCGGCTGAACGAGGTCATCGTGAAGAAATCCCGGGA
CGCCAAGCTTGTTTTGCTCAACATGCCTGGGCCTCCCCGCAACCGCAATGGTGATGAAAA
CTACATGGAGTTTCTCGAGGTCCTCACAGAGCACCTGGACCGGGTGATGCTGGTCCGCGG
CGGCGGCCGCGAGGTCATCACCATCTACTCCTGAGAACCAGGACCTGCCACCCGGGCCCG
AGCGCGCCCGGCCCGCGGCTCCGGAGCCCTCGCCGCGCCCCCCGCCGCTGTCACCGTTTA
CATACAGACCCTGTGCCCGTGTCCTGGCCCCTTACCCCGCTGCCTGAAGCCCGGAGGCCA
CGCCTGTTGGGGCTGATTCGGAGAGGGCGCCCCGCCGCGCAGAGACCAGAGCTCCTCAGT
GCCAGTTTGGCCCCTGGGTCTTCGCTGCCCTTTTTCTAAGCCCGGCCTCGTCTCGCCGGA
GGAGACGCTGCAATAAAGGTTGGGAGAAGGCGCGGAAAGGAGAGGAGCTGGGGCCTTGGG
GACCCCCAGGTAGTCCATGCGGCCCATTCCTCCCCTTCCCACTCCCGCCGCGGTCCTCGC
TCTGCGCTCCTCCGGCGCTGCTCCCTGGCTCCCGGCGGCCCGGAGGCCCGCGGGGTGGGA
AGGCCGCGCTTGCCGTCTCCGCCGCCCCTTCTCGCCGAGCCGTGGGGCGCGGGCGGCCGA
GCCTATACATAGTGTACAGGAGACATCGCGTGTATTTTTAACGTCCCCATATTTATGTGA
CTAGAAGCGCAACAGACTTCTCGCCATAGTCGAGCTCTCCCGCTGGGGGCACTGCGGGGA
GGCGAGGCCTCGGGAAGCTGAATTTTCCTTGACGTCCAAGAGTTTGAGAGCGAAAGTGCT
TTAGGCCCAGGCGGGGGTCGTGGCCTCGTTCCCTCGACACCTCCGTCCTGCTCTCGCCTC
TTCGCCCTTTCCGCGCGCCCTTGGCTTCCCACCCTCCTCTCCAGTCCTTTTCCGAGATGA
GGTGAGACAAGGGTCCAACTTTTCCTGGATTCGCCTCCCAGCGGACGTGAGCTTCCACTG
CGGCTGCAGAGACGCGAGCAACCTCTTCTCATCGGCTCTTATGCAAGTTGGGGCCAGGAT
AGGGGAGGGGTGCTCCTCAAGAGGAAGAAACCGAGAGGCCCGCGCCCCACCGAGGAAGCC
CCGCCCCGGTGCCTTCGCTGGGGAGCAGGCGTCTCTCCTCAGTCGGCTTGTCGCCTGCTC
CCCGTATCCCATGGCTCCTCGCCAAAGACTGAAATTGTGGAGCTGGAGGGCGCCCCCTCC
CCGGAGTTTCCTCCCTGGGACAAGTGAGGGAGGAGGGGGCCGATTCTGGTTTAGGGGCCG
GACCCACTGAGAGGCCCCAGAGCCGCCCGTGATGTTCCTCCCCCGTCCCCATCTGGCAGC
TCCTGTCTCGCCTGAGGGACCCAGCCGCCTTCTCCGTGCTCTGGGGCCGGGCCTCGCTGC
TTAGCAGCGGCCTCTAGCTCCGTCTCCCGGGGACCTGGGCCTGAGGGAGGGCTGGAGTCG
CACGCGCTTTGTCCTTAGCGCCTGTCTGCTCTCCTCTAACTAGGACCCAGGGCCTTTGGC
TTCCCCAGCTCATCCTTGGCCCTTCCGCTCCACCAGCCTGGTCTGAGGCGTGCTCTGTCC
TTAGAGAAGGCGCGGTGGCCGGGTTCCCTTCCCCTAGGGCACATTACTAAGGGGGTCAGG
CACTGCATGCTCGTTCCAGCACCATCTGGGACTGGGTACAGTACCTCCAGCCCCAGGGCC
CTGACCTGCGCACCTAGCTTGACATCTCACGCACCTCCCAGAGCTGGCGCCACTGAGTAA
TCCGGACCTCACCACCTCTTTTCCTTTGAGCCCAAGGCAGAGCTGGAGCTGGCGCCACCC
AGACAGCGTCAGGTGTGGCTGGGGTAGGTTTGGAGGTCTGCCAGTTACACCAAGTCCCCT
CTGAGATTCGATCAGGGGACTGGATAGATTCTTTCAGGTACTCAATCAGGAAGCTGGAGG
TGTTAGACACCAGCCCCCTGCATCCTTCAGTAGACCTCCCTCTGAACACCACAGCCAGGT
CCTGCCTTCTGGGGGCCTGAATATTCCAGAGCTGATGTGATGGGCTGTGCAGAAGGGGGC
TGTATCAACATCAATTAGGGAACCAAAGTTGCACTATCTGGGCCCAGATTGTCTGGTTGG
CAAGAGCAAAGTTTCCGTTGATGAAACAGACATCCCACAACAAAAACCCAAGTTTTCTGT
GCTACATGTGCAATATTTGTTATGAATGTTATCACAAGTCATTCATCAAGTTATCTTTAT
AATCACTGTAGTTAGATGTTTCATGTCCATTCAAGTGACTTTTATTCTGAGTGCAATATT
TCAATAGCCTTGTAGTGATAACTAGTGTTGCTTTTGTTTTAGATGATCTATGTGCAGGGC
AATGCAATGAAGTTGAAAACCCTTGTAAATAGGAGAGGTTGCAAACCAAATCAAGAGTAT
TTATTACTATTACTGCTATTATTATTAGGCCTGCCTTTAATTTTCAGTGTAAGTGTTCAG
TATGCCGCATCCTGCCTCAGTATTGATCTTGTGTTCTTTGTGCCAATATGAAAAGGAGAG
GGTTGGTTCTTTCCTTTATTGTTGAATGCTCCCATTTAATGCTTTATGGCTTTTACTGTA
TTACTTTTTTAGACTCCCGTCTGCACAAAATGCAATAAAAATAATTTTATTATACCCTTA
AAAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>57468 : length: 1139
MSRRFTVTSLPPAGPARSPDPESRRHSVADPRHLPGEDVKGDGNPKESSPFINSTDTEKG
KEYDGKNMALFEEEMDTSPMVSSLLSGLANYTNLPQGSREHEEAENNEGGKKKPVQAPRM
GTFMGVYLPCLQNIFGVILFLRLTWVVGIAGIMESFCMVFICCSCTMLTAISMSAIATNG
VVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLAYLFPAMAIFKAE
DASGEAAAMLNNMRVYGTCVLTCMATVVFVGVKYVNKFALVFLGCVILSILAIYAGVIKS
AFDPPNFPICLLGNRTLSRHGFDVCAKLAWEGNETVTTRLWGLFCSSRFLNATCDEYFTR
NNVTEIQGIPGAASGLIKENLWSSYLTKGVIVERSGMTSVGLADGTPIDMDHPYVFSDMT
SYFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPTGTILAIATTSAVYISSVVLFGACI
EGVVLRDKFGEAVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAISRDG
IVPFLQVFGHGKANGEPTWALLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACA
VQTLLRTPNWRPRFRYYHWTLSFLGMSLCLALMFICSWYYALVAMLIAGLIYKYIEYRGA
EKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLVRVDQDQNVVHPQLLSLTSQ
LKAGKGLTIVGSVLEGTFLENHPQAQRAEESIRRLMEAEKVKGFCQVVISSNLRDGVSHL
IQSGGLGGLQHNTVLVGWPRNWRQKEDHQTWRNFIELVRETTAGHLALLVTKNVSMFPGN
PERFSEGSIDVWWIVHDGGMLMLLPFLLRHHKVWRKCKMRIFTVAQMDDNSIQMKKDLTT
FLYHLRITAEVEVVEMHESDISAYTYEKTLVMEQRSQILKQMHLTKNEREREIQSITDES
RGSIRRKNPANTRLRLNVPEETAGDSEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGEG
ETDPEKVHLTWTKDKSVAEKNKGPSPVSSEGIKDFFSMKPEWENLNQSNVRRMHTAVRLN
EVIVKKSRDAKLVLLNMPGPPRNRNGDENYMEFLEVLTEHLDRVMLVRGGGREVITIYS