ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

57332

Name

CBX8

Synonym

PC3|RC1;chromobox homolog 8;CBX8;chromobox homolog 8

Definition

Pc class 3 homolog|chromobox homolog 8 (Pc class homolog, Drosophila)|chromobox protein homolog 8|polycomb 3|rectachrome 1

Position

17q25.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

57332

Links to epithelial mesenchymal transition gene database

57332

Links to ovarian cancer gene database

57332

Links to endometrial cancer gene database

57332

Links to iHOP

57332

Sequence Information

Nucleotide Sequence

>57332 : length: 1561
GAGAGCGCCGGGAGGGGGAGGAGAACTGACGTCAGCGGGAGAGTATTATGGTCTGTCGTG
CGCTGGCTGCTGCTTTTCTGCTCCTGGAAGCGGCCAAGGGGGGAAGCGGCGAGTCAACAT
GGAGCTTTCAGCGGTGGGGGAGCGGGTGTTCGCGGCCGAAGCCCTCCTGAAGCGGCGCAT
ACGGAAAGGACGCATGGAATACCTCGTGAAATGGAAGGGATGGTCGCAGAAGTACAGCAC
ATGGGAACCGGAGGAAAACATCCTGGATGCTCGCTTGCTCGCAGCCTTTGAGGAAAGGGA
AAGAGAGATGGAGCTCTATGGCCCCAAAAAGCGTGGACCCAAGCCCAAAACCTTCCTCCT
CAAAGCGCAGGCCAAGGCAAAGGCCAAAACTTACGAGTTTCGAAGTGACTCAGCCAGGGG
CATCCGGATCCCCTACCCTGGCCGCTCGCCCCAGGACCTGGCCTCCACTTCCCGGGCCCG
GGAGGGCCTTCGAAACATGGGTTTGTCCCCGCCAGCGAGCAGCACCAGCACCAGCAGCAC
CTGCCGCGCAGAGGCCCCTCGGGACCGGGACCGAGACCGGGATAGGGACCGGGAGCGGGA
TCGAGAAAGGGAGAGGGAGCGAGAGAGGGAGCGGGAACGTGAGAGGGAACGAGAGCGGGG
TACCAGCAGAGTGGATGACAAGCCCAGCTCACCGGGGGACAGCTCGAAGAAGCGAGGCCC
CAAGCCCCGGAAGGAGCTCCCGGACCCCTCACAGAGGCCCTTAGGCGAACCCAGCGCCGG
CCTCGGAGAGTACCTCAAGGGCAGGAAGCTGGACGACACCCCTTCCGGGGCAGGAAAGTT
TCCAGCCGGCCACAGTGTGATCCAGCTGGCCCGAAGACAGGACTCGGACCTGGTGCAGTG
TGGTGTGACCAGCCCTAGCTCAGCTGAGGCCACGGGCAAACTGGCTGTGGACACCTTCCC
GGCCAGGGTGATAAAGCACAGGGCTGCCTTCCTGGAGGCCAAAGGCCAGGGTGCCCTAGA
TCCCAATGGCACCCGGGTCCGACATGGCTCAGGCCCCCCCAGCTCTGGGGGGGGCCTGTA
CCGGGACATGGGGGCCCAGGGGGGAAGGCCCTCCCTCATCGCCAGGATCCCTGTGGCCAG
AATCCTGGGGGACCCGGAGGAAGAGTCCTGGAGCCCCTCCCTGACTAACCTGGAGAAGGT
GGTGGTCACGGACGTGACCTCAAACTTTTTGACCGTCACCATTAAGGAAAGTAACACGGA
CCAAGGCTTTTTTAAAGAGAAAAGATGAATGCTGGGTGGGTGTGTCCAGGAGGAGAGCAG
GGGAGAGAGTGAGCGTGAGCTTGGCATAGTGATTTTTATTTCTGGGTGGGATGTGGCCTT
TTGGCTGGTCCCGTCCCTGATGTCACCCCCACCCCACCAGCCCCTTTCATCCCTCCTTCC
TCCCCCTCAGTTTTTGTTGGAAAGATTATCTCTAGAGTTATATTTTCTATTAGATGTAAA
TATGTTATTTAAGAAAAATATCTAAATATATATATTTCAACTCGAAAAAAAAAAAAAAAA
A

Protein Sequence

>57332 : length: 389
MELSAVGERVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEER
EREMELYGPKKRGPKPKTFLLKAQAKAKAKTYEFRSDSARGIRIPYPGRSPQDLASTSRA
REGLRNMGLSPPASSTSTSSTCRAEAPRDRDRDRDRDRERDRERERERERERERERERER
GTSRVDDKPSSPGDSSKKRGPKPRKELPDPSQRPLGEPSAGLGEYLKGRKLDDTPSGAGK
FPAGHSVIQLARRQDSDLVQCGVTSPSSAEATGKLAVDTFPARVIKHRAAFLEAKGQGAL
DPNGTRVRHGSGPPSSGGGLYRDMGAQGGRPSLIARIPVARILGDPEEESWSPSLTNLEK
VVVTDVTSNFLTVTIKESNTDQGFFKEKR