ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5727

Name

PTCH1

Synonym

BCNS|HPE7|NBCCS|PTC|PTC1|PTCH|PTCH11;patched 1;PTCH1;patched 1

Definition

PTCH protein +12b|PTCH protein +4'|PTCH protein -10|PTCH protein -3,4,5|protein patched homolog 1

Position

9q22.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Hedgehog signaling events mediated by Gli proteins;PID Curated;200147

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Hedgehog signaling pathway;PANTHER;P00025

Pathway

Glypican 3 network;PID Curated;200193

Pathway

Signaling events mediated by the Hedgehog family;PID Curated;200144

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Hedgehog signaling pathway;KEGG PATHWAY;hsa04340

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

sonic hedgehog receptor ptc1 regulates cell cycle;PID BioCarta;100060

Pathway

Class B/2 (Secretin family receptors);PID Reactome;500428

Disease

Basal cell carcinoma, somatic;OMIM

Disease

Height;NHGRI

Disease

Cancers;KEGG DISEASE

Disease

Plasma chemerin levels;NHGRI

Disease

Pulmonary function;NHGRI

Disease

Holoprosencephaly-7;OMIM

Disease

pulmonary function;GAD

Disease

breast cancer;GAD

Disease

CARDIOVASCULAR;GAD

Disease

Basal cell carcinoma;KEGG DISEASE;H00039

Disease

DEVELOPMENTAL;GAD

Disease

CANCER;GAD

Disease

Basal cell nevus syndrome;OMIM

Disease

proximal chromosome 9p to q and distal chromosome 9q;GAD

Disease

nevoid basal cell carcinoma syndrome associated;GAD

Disease

Skin cancers;KEGG DISEASE

Disease

height;GAD

Disease

skin cancer, non-melanoma;GAD

External Links

Links to cell senescence gene database

5727

Links to epithelial mesenchymal transition gene database

5727

Links to ovarian cancer gene database

5727

Links to endometrial cancer gene database

5727

Links to iHOP

5727

Sequence Information

Nucleotide Sequence

>5727 : length: 8065
ACCCAGGAGGGCTGTGCTGATAGCACGTTCCTCGAGTTTACTTTGCTTTCCTTGAGTTTA
TTGTAAAGGGGTAAAGTTTTCGGATCCGTCACGTGACCCTGACAGGTCCTGCCTATGGCG
CGGCAGACCACCCACGCCGAGGGCCATGGAACTGCTTAATAGAAACAGGCTTGTAATTGT
GAGTCCGCGCTGCACTCCGCCGAAAGCCTCCGGCGGCCCAGCGCGCCGGGGTTTTTACAC
TTTCCGTTCCTTTTGTAAAGACGGAGGAGGAGGAGAAGAAGAAGAAGAAAACGGAGGAGA
AGAAAAAGACGACAGGGGAGACAAAGAGACCCGCAGCGACAAGGCAAGGGGGAGACGAGG
GAAGACTGGGAGAAGACGGAGGAGCGGAGGACGAGGAAAGGGGGGCCAGGGAAAAAAAAG
GAATTGATGTGAAATCCAAGCCCAGCGTCCGCGCCATCGGCACCCGCGCTCCGAGCAGGG
GTTGACGGCCGGCTATGGGGAAGGCTACTGGCCGGAAAGCGCCGCTGTGGCTGAGAGCGA
AGTTTCAGAGACTCTTATTTAAACTGGGTTGTTACATTCAAAAAAACTGCGGCAAGTTCT
TGGTTGTGGGCCTCCTCATATTTGGGGCCTTCGCGGTGGGATTAAAAGCAGCGAACCTCG
AGACCAACGTGGAGGAGCTGTGGGTGGAAGTTGGAGGACGAGTAAGTCGTGAATTAAATT
ATACTCGCCAGAAGATTGGAGAAGAGGCTATGTTTAATCCTCAACTCATGATACAGACCC
CTAAAGAAGAAGGTGCTAATGTCCTGACCACAGAAGCGCTCCTACAACACCTGGACTCGG
CACTCCAGGCCAGCCGTGTCCATGTATACATGTACAACAGGCAGTGGAAATTGGAACATT
TGTGTTACAAATCAGGAGAGCTTATCACAGAAACAGGTTACATGGATCAGATAATAGAAT
ATCTTTACCCTTGTTTGATTATTACACCTTTGGACTGCTTCTGGGAAGGGGCGAAATTAC
AGTCTGGGACAGCATACCTCCTAGGTAAACCTCCTTTGCGGTGGACAAACTTCGACCCTT
TGGAATTCCTGGAAGAGTTAAAGAAAATAAACTATCAAGTGGACAGCTGGGAGGAAATGC
TGAATAAGGCTGAGGTTGGTCATGGTTACATGGACCGCCCCTGCCTCAATCCGGCCGATC
CAGACTGCCCCGCCACAGCCCCCAACAAAAATTCAACCAAACCTCTTGATATGGCCCTTG
TTTTGAATGGTGGATGTCATGGCTTATCCAGAAAGTATATGCACTGGCAGGAGGAGTTGA
TTGTGGGTGGCACAGTCAAGAACAGCACTGGAAAACTCGTCAGCGCCCATGCCCTGCAGA
CCATGTTCCAGTTAATGACTCCCAAGCAAATGTACGAGCACTTCAAGGGGTACGAGTATG
TCTCACACATCAACTGGAACGAGGACAAAGCGGCAGCCATCCTGGAGGCCTGGCAGAGGA
CATATGTGGAGGTGGTTCATCAGAGTGTCGCACAGAACTCCACTCAAAAGGTGCTTTCCT
TCACCACCACGACCCTGGACGACATCCTGAAATCCTTCTCTGACGTCAGTGTCATCCGCG
TGGCCAGCGGCTACTTACTCATGCTCGCCTATGCCTGTCTAACCATGCTGCGCTGGGACT
GCTCCAAGTCCCAGGGTGCCGTGGGGCTGGCTGGCGTCCTGCTGGTTGCACTGTCAGTGG
CTGCAGGACTGGGCCTGTGCTCATTGATCGGAATTTCCTTTAACGCTGCAACAACTCAGG
TTTTGCCATTTCTCGCTCTTGGTGTTGGTGTGGATGATGTTTTTCTTCTGGCCCACGCCT
TCAGTGAAACAGGACAGAATAAAAGAATCCCTTTTGAGGACAGGACCGGGGAGTGCCTGA
AGCGCACAGGAGCCAGCGTGGCCCTCACGTCCATCAGCAATGTCACAGCCTTCTTCATGG
CCGCGTTAATCCCAATTCCCGCTCTGCGGGCGTTCTCCCTCCAGGCAGCGGTAGTAGTGG
TGTTCAATTTTGCCATGGTTCTGCTCATTTTTCCTGCAATTCTCAGCATGGATTTATATC
GACGCGAGGACAGGAGACTGGATATTTTCTGCTGTTTTACAAGCCCCTGCGTCAGCAGAG
TGATTCAGGTTGAACCTCAGGCCTACACCGACACACACGACAATACCCGCTACAGCCCCC
CACCTCCCTACAGCAGCCACAGCTTTGCCCATGAAACGCAGATTACCATGCAGTCCACTG
TCCAGCTCCGCACGGAGTACGACCCCCACACGCACGTGTACTACACCACCGCTGAGCCGC
GCTCCGAGATCTCTGTGCAGCCCGTCACCGTGACACAGGACACCCTCAGCTGCCAGAGCC
CAGAGAGCACCAGCTCCACAAGGGACCTGCTCTCCCAGTTCTCCGACTCCAGCCTCCACT
GCCTCGAGCCCCCCTGTACGAAGTGGACACTCTCATCTTTTGCTGAGAAGCACTATGCTC
CTTTCCTCTTGAAACCAAAAGCCAAGGTAGTGGTGATCTTCCTTTTTCTGGGCTTGCTGG
GGGTCAGCCTTTATGGCACCACCCGAGTGAGAGACGGGCTGGACCTTACGGACATTGTAC
CTCGGGAAACCAGAGAATATGACTTTATTGCTGCACAATTCAAATACTTTTCTTTCTACA
ACATGTATATAGTCACCCAGAAAGCAGACTACCCGAATATCCAGCACTTACTTTACGACC
TACACAGGAGTTTCAGTAACGTGAAGTATGTCATGTTGGAAGAAAACAAACAGCTTCCCA
AAATGTGGCTGCACTACTTCAGAGACTGGCTTCAGGGACTTCAGGATGCATTTGACAGTG
ACTGGGAAACCGGGAAAATCATGCCAAACAATTACAAGAATGGATCAGACGATGGAGTCC
TTGCCTACAAACTCCTGGTGCAAACCGGCAGCCGCGATAAGCCCATCGACATCAGCCAGT
TGACTAAACAGCGTCTGGTGGATGCAGATGGCATCATTAATCCCAGCGCTTTCTACATCT
ACCTGACGGCTTGGGTCAGCAACGACCCCGTCGCGTATGCTGCCTCCCAGGCCAACATCC
GGCCACACCGACCAGAATGGGTCCACGACAAAGCCGACTACATGCCTGAAACAAGGCTGA
GAATCCCGGCAGCAGAGCCCATCGAGTATGCCCAGTTCCCTTTCTACCTCAACGGCTTGC
GGGACACCTCAGACTTTGTGGAGGCAATTGAAAAAGTAAGGACCATCTGCAGCAACTATA
CGAGCCTGGGGCTGTCCAGTTACCCCAACGGCTACCCCTTCCTCTTCTGGGAGCAGTACA
TCGGCCTCCGCCACTGGCTGCTGCTGTTCATCAGCGTGGTGTTGGCCTGCACATTCCTCG
TGTGCGCTGTCTTCCTTCTGAACCCCTGGACGGCCGGGATCATTGTGATGGTCCTGGCGC
TGATGACGGTCGAGCTGTTCGGCATGATGGGCCTCATCGGAATCAAGCTCAGTGCCGTGC
CCGTGGTCATCCTGATCGCTTCTGTTGGCATAGGAGTGGAGTTCACCGTTCACGTTGCTT
TGGCCTTTCTGACGGCCATCGGCGACAAGAACCGCAGGGCTGTGCTTGCCCTGGAGCACA
TGTTTGCACCCGTCCTGGATGGCGCCGTGTCCACTCTGCTGGGAGTGCTGATGCTGGCGG
GATCTGAGTTCGACTTCATTGTCAGGTATTTCTTTGCTGTGCTGGCGATCCTCACCATCC
TCGGCGTTCTCAATGGGCTGGTTTTGCTTCCCGTGCTTTTGTCTTTCTTTGGACCATATC
CTGAGGTGTCTCCAGCCAACGGCTTGAACCGCCTGCCCACACCCTCCCCTGAGCCACCCC
CCAGCGTGGTCCGCTTCGCCATGCCGCCCGGCCACACGCACAGCGGGTCTGATTCCTCCG
ACTCGGAGTATAGTTCCCAGACGACAGTGTCAGGCCTCAGCGAGGAGCTTCGGCACTACG
AGGCCCAGCAGGGCGCGGGAGGCCCTGCCCACCAAGTGATCGTGGAAGCCACAGAAAACC
CCGTCTTCGCCCACTCCACTGTGGTCCATCCCGAATCCAGGCATCACCCACCCTCGAACC
CGAGACAGCAGCCCCACCTGGACTCAGGGTCCCTGCCTCCCGGACGGCAAGGCCAGCAGC
CCCGCAGGGACCCCCCCAGAGAAGGCTTGTGGCCACCCCCCTACAGACCGCGCAGAGACG
CTTTTGAAATTTCTACTGAAGGGCATTCTGGCCCTAGCAATAGGGCCCGCTGGGGCCCTC
GCGGGGCCCGTTCTCACAACCCTCGGAACCCAGCGTCCACTGCCATGGGCAGCTCCGTGC
CCGGCTACTGCCAGCCCATCACCACTGTGACGGCTTCTGCCTCCGTGACTGTCGCCGTGC
ACCCGCCGCCTGTCCCTGGGCCTGGGCGGAACCCCCGAGGGGGACTCTGCCCAGGCTACC
CTGAGACTGACCACGGCCTGTTTGAGGACCCCCACGTGCCTTTCCACGTCCGGTGTGAGA
GGAGGGATTCGAAGGTGGAAGTCATTGAGCTGCAGGACGTGGAATGCGAGGAGAGGCCCC
GGGGAAGCAGCTCCAACTGAGGGTGATTAAAATCTGAAGCAAAGAGGCCAAAGATTGGAA
ACCCCCCACCCCCACCTCTTTCCAGAACTGCTTGAAGAGAACTGGTTGGAGTTATGGAAA
AGATGCCCTGTGCCAGGACAGCAGTTCATTGTTACTGTAACCGATTGTATTATTTTGTTA
AATATTTCTATAAATATTTAAGAGATGTACACATGTGTAATATAGGAAGGAAGGATGTAA
AGTGGTATGATCTGGGGCTTCTCCACTCCTGCCCCAGAGTGTGGAGGCCACAGTGGGGCC
TCTCCGTATTTGTGCATTGGGCTCCGTGCCACAACCAAGCTTCATTAGTCTTAAATTTCA
GCATATGTTGCTGCTGCTTAAATATTGTATAATTTACTTGTATAATTCTATGCAAATATT
GCTTATGTAATAGGATTATTTTGTAAAGGTTTCTGTTTAAAATATTTTAAATTTGCATAT
CACAACCCTGTGGTAGTATGAAATGTTACTGTTAACTTTCAAACACGCTATGCGTGATAA
TTTTTTTGTTTAATGAGCAGATATGAAGAAAGCACGTTAATCCTGGTGGCTTCTCTAGGT
GTCGTTGTGTGCGGTCCTCTTGTTTGGCTGTGCGTGTGAACACGTGTGTGAGTTCACCAT
GTACTGTACTGTGATTTTTTTTTTGTCTTGTTTTGTTTCTCTACACTGTCTGTAACCTGT
AGTAGGCTCTGACCTAGTCAGGCTGGAAGCGTCAGGATATCTTTTCTTCGTGCTGGTGAG
GGCTGGCCCTAAACATCCACCTAATCCTTTCAAATCAGCCCGGCAAAAGCTAGACTCTCC
TCGTGTCTACGGCATCTCTTATGATCATTGGCTGCCATCCAGGACCCCAATTTGTGCTTC
AGGGGGATAATCTCCTTCTCTCGGATCATTGTGATGGATGCTGGAACCTCAGGGTATGGA
GCTCACATCAGTTCATCATGGTGGGTGTTAGAGAATTCGGTGACATGCCTAGTGCTGAGC
CTTGGCTGGGCCATGAGAGTCTGTATACTCTAAAAAGCATGCAGCATGGTGCCCCTCTTC
TGACCAACACACACACGACCCCTCCCCCAACACCCCCAAATTCAAGAGTGGATGTGGCCC
TGTCACAGGTAGAAAAACCTATTTAGTTAATTCTTTCTTGGCCCACAGTCTCCCAGAAAT
GATGTTTTGAGTCCCTATAGTTTAAACTCCCTCTCTTAAATGGAGCAGCTGGTTGAGGCT
TTCTAGATCTGTTTGCATCTTCTTTAAAACTAAGTGGTGAGCATGCATTGTGGTGTAGAG
GCAGGCATTATGTAGGATAAGAGCTCCGGGGGGATTCTTCATGCACCAGTGTTTAGGGTA
CGTGCTTCCTAAGTAAATCCAAACATTGTCTCCATCCTCCCCGTCATTAGTGCTCTTTCA
ATGTGATGTGGGAAAGCAGGAGGATGGACACACCCCACTGAAAGATGTAGGCAGGGGCAG
GTCTCTCAACCAGGCATATTTTTAAAAGTTGCTTCTGTACTGGTTCTCTTCTTTTGCTCT
GAGGTGTGGGCTCCCTCATCTCGTAACCAGAGACCAGCACATGTCAGGGAAGCACCCAGT
GTCGGCTCCCCATCCAAATCCACACCAGCACCTTGTTACAGACAAGAAGTCAGAGGAAAG
GGCGGGGTCCCTGCAGGGCTGAAGCCTAAGCTACTGTGAGGCGCTCACGAGTGGCAGCTC
CTGTTACTCCCTTTTAAATTACCTGGGAAATCTTAACAGAAAGGTAATGGGCCCCCAGAA
ATACCCACAGCATAGTGACCTCAGACCCTGATACTCACCACAAAACTTTTAAGATGCTGA
TTGGGAGCCGCTTGTGGCTGCTGGGTGTGTGTGTGTGTGTGTGCGTGCGTGCGTGTGTGT
GTGTCTCTGCTGGGGACCCTGGCCACCCCCCTGCTGCTGTCTTGGTGCCTGTCACCCACA
TGGTCTGCCATCCTAACACCCAGCTCTGCTCAGAAAACGTCCTGCGTGGAGGAGGGATGA
TGCAGAATTCTGAAGTCGACTTCCCTCTGGCTCCTGGCGTGCCCTCGCTCCCTTCCTGAG
CCCAGCTCGTGTTGCGCCGGAGGCTGCGCGGCCCCTGATTTCTGCATGGTGTAGAACTTT
CTCCAATAGTCACATTGGCAAAGGGAGAACTGGGGTGGGCGGGGGGTGGGGCTGGCAGGG
AATTAGAATTTCTCTCTCTCTTTTAATAGTTTTATTTTGTCTGTCCTGTTTGTTCATTTG
GATGTTTTAATTTTTAAAAAAAAAAAAACTTTGCTGATATTTATAATTTTGTATCATAAG
AATGTTTTCCTCTACAGTATTTGTCATGCCAGTTTATAACAAAAAAAAATGCAGGGATTT
TATTTCTATTGGAAACATTACAGCTATGTTTTACTTTTGGACAGAATTTTTATTTGTATA
GAGTGCTTACTAATGTTAAATAGTTCAGAGTATATAACATTTACATTAAGGACTCATGGT
AGGTTTTAGGGTAAGGAGTTTAAAGGAAATAAATATTCAAACTGGGTCTCATTGCCAATT
TTGGTGGAAATGAGTTTGTGTCATTTCAATTACAAAGATAAAAGTATGCCATATAATTTA
TTTATATGAAGATTTATTTTTGTAGTGTACATAGTAGTCATCAAGTCTTTTGACAGAAGT
ATATTTTTAAAGAATTTATATGTGATGAATCCATAATGTCTGGAACTTTGCTGAGACATG
AGTGGGCACAGTTTTCATTGTAAATTACAGCAAGGAAAGAAAATGTTTAACAGTGTTAAG
AGAGTCAGAGCAGAGTGGATATTCATGCGATTATGAAGTGTTTATTAGTTACCATTGGCG
ACCTAGCATGCTTCTCATTTCAAACCTTGGAAGGTGAAAATGTACAAACTCTCTAAATAA
TTAATGTTCAAACACTGATAGAAATTCTAACATGAATAAAAAATAATATAACTTGTTGGT
TATATCTTTGTTTGTAGAATGCTTTTTTTCTTTAAAATACTTGGGAGAGACAGTTAGTGT
TGGAGCCATCAGAAACTGTTGTTTCATCTTGCTGACCTTGTGACACTCTTCTTTTTTGCT
CTATCTGATGGAGAGAGTTTTAGGTTTTCCTCCTTTTTGTTTTGTATAAATAGTGGGTAT
AAGCATAGCTCTGTTACATGGATGTATTACAAAGTGGGGGCTGAGCTTTTAGTGTGATCA
TCACCCAAATAGTGTACATTGTACCCATTAATTAATTTCTTATCACCTGACCCTATTTTT
GTTTTCTCATACCAAGAAACTTCCTAAGTTAACCATCAAAATTAGTCCTTCTGTCATCTC
TCTTAGCATACTTATTTCCCTTATGTGATGCCTAATAATGAGGGAACATAAATAAAGCCA
AATTCAAAGATAAAAAAAAAAAAAA

Protein Sequence

>5727 : length: 1447
MASAGNAAEPQDRGGGGSGCIGAPGRPAGGGRRRRTGGLRRAAAPDRDYLHRPSYCDAAF
ALEQISKGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAAN
LETNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLD
SALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEGAK
LQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPA
DPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHAL
QTMFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAWQRTYVEVVHQSVAQNSTQKVL
SFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALS
VAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGEC
LKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDL
YRREDRRLDIFCCFTSPCVSRVIQVEPQAYTDTHDNTRYSPPPPYSSHSFAHETQITMQS
TVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSCQSPESTSSTRDLLSQFSDSSL
HCLEPPCTKWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDI
VPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHRSFSNVKYVMLEENKQL
PKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDIS
QLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPETR
LRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYTSLGLSSYPNGYPFLFWEQ
YIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSA
VPVVILIASVGIGVEFTVHVALAFLTAIGDKNRRAVLALEHMFAPVLDGAVSTLLGVLML
AGSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEP
PPSVVRFAMPPGHTHSGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATE
NPVFAHSTVVHPESRHHPPSNPRQQPHLDSGSLPPGRQGQQPRRDPPREGLWPPPYRPRR
DAFEISTEGHSGPSNRARWGPRGARSHNPRNPASTAMGSSVPGYCQPITTVTASASVTVA
VHPPPVPGPGRNPRGGLCPGYPETDHGLFEDPHVPFHVRCERRDSKVEVIELQDVECEER
PRGSSSN