ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

57222

Name

ERGIC1

Synonym

ERGIC-32|ERGIC32|NET24;endoplasmic reticulum-golgi intermediate compartment (ERGIC) 1;ERGIC1;endoplasmic reticulum-golgi intermediate compartment (ERGIC) 1

Definition

ER-Golgi intermediate compartment 32 kDa protein|endoplasmic reticulum-Golgi intermediate compartment protein 1|endoplasmic reticulum-golgi intermediate compartment 32 kDa protein

Position

5q35.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

57222

Links to epithelial mesenchymal transition gene database

57222

Links to ovarian cancer gene database

57222

Links to endometrial cancer gene database

57222

Links to iHOP

57222

Sequence Information

Nucleotide Sequence

>57222 : length: 2949
GGGCGGCGCCCAATGGGCTGCGCGGAGCGTCACTTCCCGGCAGCGGGAGGCGAGTGGCGA
GTGGCGAGTGGCGAGTGTCAGGGGGGCGGCCGGCGGGGGCGGGGCGGCCGGAGGAGGCGT
TGGCAGCGGGCTCGGACCCACGCGGCGCCGCGGCCCGCCTGGCCTGCAGCGCTCCCACCC
CCGGCGGCGGCACGATGCCCTTTGACTTCAGGAGGTTTGACATCTACAGGAAGGTGCCCA
AGGACCTTACGCAGCCAACGTACACCGGGGCCATTATCTCCATCTGCTGCTGCCTCTTCA
TCCTCTTCCTCTTCCTCTCGGAGCTCACCGGATTTATAACGACAGAAGTTGTGAACGAGC
TCTATGTCGATGACCCAGACAAGGACAGCGGTGGCAAGATCGACGTCAGTCTGAACATCA
GTTTACCCAATCTGCACTGCGAGTTGGTTGGGCTTGACATTCAGGATGAGATGGGCAGGC
ACGAAGTGGGCCACATCGACAACTCCATGAAGATCCCGCTGAACAATGGGGCAGGCTGCC
GCTTCGAGGGGCAGTTCAGCATCAACAAGGTCCCCGGCAACTTCCACGTGTCCACACACA
GTGCCACAGCCCAGCCACAGAACCCAGACATGACGCATGTCATCCACAAGCTCTCCTTTG
GGGACACGCTACAGGTCCAGAACATCCACGGAGCTTTCAATGCTCTCGGGGGAGCAGACA
GACTCACCTCCAACCCCCTGGCCTCCCACGACTACATCCTGAAGATTGTGCCCACGGTTT
ATGAGGACAAGAGTGGCAAGCAGCGGTACTCCTACCAGTACACGGTGGCCAACAAGGAAT
ACGTCGCCTACAGCCACACGGGCCGCATCATCCCTGCAATCTGGTTCCGCTACGACCTCA
GCCCCATCACGGTCAAGTACACAGAGAGACGGCAGCCGCTGTACAGATTCATCACCACGA
TCTGTGCCATCATTGGCGGGACCTTCACCGTCGCCGGCATCCTGGACTCATGCATCTTCA
CAGCCTCTGAGGCCTGGAAGAAGATCCAGCTGGGCAAGATGCATTGACGCCACACCCAGC
CTAATGGCCGAGGACCCTGGGCATCGCCAGCCTTGCCTCCAGTGCCCTGTCTCCTTTGGC
CCTCAATCTGGTCCCAAATCTGGCTGTGTCCCAAAGGGTGTGTGGGAAGTGGGGGGAAAG
TAGAGGATGGCTCGATGTTTTGCAGCTACCTCTTTTCCCCGTGTTTCTTTTTAGACAAAT
TACACTGCCTGAAGTTGCAGTTCCCCTTTCCCTGGGGAGCCCCAAGAACAGAGTCAGGCA
AGGGGTGGGGAGTCCAGGGATCTTGGGGACCCCTCCTAGGAGAGCTGCAGTCTCTTCCCT
CAGGGGAACATCCCAGAATGCATATCGATCAGCTCTCAGCCAGGCTTCGACAATCTCGCA
GCCCCCACTAGGTGGACACATTAATGATTTGGTTTCTCCCCTGGGCAGCCAACCTGCCCC
AGAGGCACCAGACCTGGGCTTTCAGCTTTGGGACCAGGCTGCCCAAAGGTACTCCTTTAT
ACACCCGGCACCTTCCACGAAAGATGGTACTTCCCAAGCAAGCCCCTATGATTTGTCACT
ATAGATGGAACCCTGACTTCTGCCCCATCCCTTCCTGCCCAACCTAGAACCCAGGCCTCA
AGTCTTTACCCCACCCCTTTCTTGTTCTTCCAAGAAGCAGATGCCCAGTTGCTCAGCAGC
AGCGGTAGAGACTTGAATCTGCCCACCAGTCACAAGGCGGGTCACAGATTCCTCTTCCTC
TCTTCTCCTCGTTCCTCTGAACCCTCCACCAATGTGCCTCAGCCTGTGTGCTGTGTGGCA
ACAGCATTCTGGTTCCCACTGCCAAGATCTCCCACCACTCTGCTGGGATCTGCAGTGGCA
GGGAGTGGGGGTTGTGTAAAGGGGAAGTCATCTTTTGAGATCCAGATAGACATGGTTTGT
GCACTTACGTCCAGATGGGAAGCATCCTTCCTGCAACCCTAAAATAATCATGCAGCCTCT
CAGACGGACGCCATCGGTCCCAAGGCCTTAGGTGGAGGAAGCAAAGCAGGCCAGGCCTGT
CCTGTCCGTGGACCTCTACCTTCTGGACTCCCTACGGGTGCAGAGCACTTGGGTTTCTCT
ACAGCCATCGTGGCCCACTTGACACTGTGCTCCTCCATCAGCTGGTCACATGCCAACACG
TTCCCAGCCCCTGAGGCAGCTCCAGGGTGCCCCACCTGCTCCTGAGGTGGGTCCCTACCC
TGCTGCTCCTCTTCATCCTTTCCCTTTTGTCCTGAAAGGGAGGAGCAATGGTCCAGGCAT
TAATTCCACCCAGGGAATTTTAGCTATGCCCTCATGTCCCAGGGAGAGAGCCACACGCCT
GTTTTCCATTTATAGCAAGATTGTTTGCATACTTTTGTAATGAAGGGGAGTGTCCAGTGG
AAGGATTTTTAAAATTATCTTATGGATAGCTCAAGTCTCTGCCATTTGTAATTTTTGGCT
CTAAGCTCCGATTGGAGACGCTTCTCCTTGTGCATGTGAGTTGACTGATGTTGTGAGTGT
AAATGCATTTGGTTATTTCTGGTATCGGTGGCCACTTGGATGGATTTTTTTACATTCTGT
TCCCCAGTTACAGGAAGGAGTCCCTTTGGTGTGTGAATATGTGTGCCTGTAGAGGGTGGG
GCAGGGTGGGGTGGGGATGGAAATGTGTGGCATGCACATGAGTTGAAATTCTTTTATGCA
TTTTTTTGAAGAAAAAAAAAAAAACAACTCTGAGGACATAGGGGATGTCAGTTTCCTATG
GAAGAGACACCTCTGACCCGTTATTCTTATAATCAAAATCTGAAGGGAAAAAAATGTTTT
AGTTCTTTCCCCACTCGTTGGGTTCAACTAGATTAAAAGGCTGATTTTCAGAAATAAAAA
AAAAAAAAA

Protein Sequence

>57222 : length: 314
MGGRAGQGRFPPCSLSSWDGLWPPVTWNWNKFDIYRKVPKDLTQPTYTGAIISICCCLFI
LFLFLSELTGFITTEVVNELYVDDPDKDSGGKIDVSLNISLPNLHCELVGLDIQDEMGRH
EVGHIDNSMKIPLNNGAGCRFEGQFSINKVPGNFHVSTHSATAQPQNPDMTHVIHKLSFG
DTLQVQNIHGAFNALGGADRLTSNPLASHDYILKIVPTVYEDKSGKQRYSYQYTVANKEY
VAYSHTGRIIPAIWFRYDLSPITVKYTERRQPLYRFITTICAIIGGTFTVAGILDSCIFT
ASEAWKKIQLGKMH