ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

57167

Name

SALL4

Synonym

DRRS|HSAL4|ZNF797|dJ1112F19.1;spalt-like transcription factor 4;SALL4;spalt-like transcription factor 4

Definition

sal-like protein 4|zinc finger protein 797|zinc finger protein SALL4

Position

20q13.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Disease

REPRODUCTION;GAD

Disease

smoking cessation;GAD

Disease

CHEMDEPENDENCY;GAD

Disease

Duane retraction syndrome;FunDO

Disease

IVIC syndrome;OMIM

Disease

male infertility;GAD

Disease

Male infertility;NHGRI

Disease

Leukemia;FunDO

Disease

Congenital abnormality;FunDO

Disease

Deafness;FunDO

Disease

Duane-radial ray syndrome;OMIM

External Links

Links to cell senescence gene database

57167

Links to epithelial mesenchymal transition gene database

57167

Links to ovarian cancer gene database

57167

Links to endometrial cancer gene database

57167

Links to iHOP

57167

Sequence Information

Nucleotide Sequence

>57167 : length: 6151
ACTCCTGGCGGCTAGAATGTGTTTGCAGAGCCTCCAATTGCCTCCTTGGGAGAGAAGGTT
GTTTTCCCAAGCAGTGCGTTTTTAATGGCTGCGTTTGGGTTGTTTGCATTTGAGCTGCCT
AAAATTATATGTGTTAGGTATATAATGTAGACATACATATCTAACTTAGATGTATGTATA
TGTCTCACATAATTTTTTAGAATGCAGATTGAGCTGGTCTTATTTTGCAAAGCCATTCGA
GAATGCAGTTTTTGAGGGAGGAAAATGACGTCTGGCGATCAATTAGCAGATCAAAAAATC
TGCAGGTGGTCGCAGGGCTAACACTACATACAGGAAAAATTAGCATTTTCTCAAAAGAGT
TTCAAATGCCCTTTGTGCTAAACTGGATTACAAACATCAACGATTAGGATTCCCAAGTTT
CGAATAACTTCCTATTTCCAATTACTCACCAAAATGACCTACGCTGGCTTAGAAGGATTT
TGACGTTAGTTAACGTTTCAGGTCAACTTTCTACGTTAGACTTCATGTGGGTTTCCCATA
GGGAGAGAAGCTACAATTTGCCAAACAGCTCCTTTTGTTGAATAAAAATGTGCAGTGCAG
AAGCAAATGATACTTTGTCATTCGTGCTGCTGTTAGTGAGCTTCCTCCTGGGCTGTGGGT
TGGGGAACCATCTTGGGAGGCAGAAGGCAGTTAGCATTTCCTTTTTTAAAATGTGAAGTG
TTAGGTTGATGCCTGGGAAGTCAGGTTTTAGAATGGGATCCGCGTTCCACTGTGGCTGTG
TGACTTTCAGCTGTGTAACCTTGAAGCCAGCTTGGTGGCGTTTTCTGTTTTTTTGTTTTT
TCTGAGTTTTTGGGTTCCTCCTCTATATAGCAGTGATAAAATGCCCTGTTTAGATAATTT
CAACTATAGAAGGGCTACTATGAATTGGGAATGTGATCAGTCTTAATTTTGTTCAAAATA
CCAAAATGTTTTTATTTGTGTTTATTGTGTCAAGATGGTGTTGAGCTGCCAGTTGAGGCA
ATCTAGCAGAAATGGCAGTGTGCTGCCTGCCAGACACCAGGCTGGGGACTCGAGTGCGCT
ATCTTTAATTCAAGATATTAAAGACCAAAAGTGATAGTCATGTTTTTACTCATTTTAAAT
TGCAGCACCTGTTTGAAATGGCTTTGCCCGTGGTGCCTTGCCCTGCTTGATGGCCCATGG
TGTCTTGTCCTGCCTCGCCCCAGAGCCCAAGGAACTGTTTTTTTTGTTTTGTTTTGTTTT
GTTTTGTTTTGTTTTTATTGGTTTTTTAAAAATAACCTTAGGTCAGTTGGTGATGTGATG
AGATGTTCTTTTTGGCATCTTCGACAAGGGAGCCGTGATTGGTGCTTGGCTGGTTGGGTT
TGGTGGCCTCTCCTCTGCCATCTTAAATGTTGGGATGTGCCTTCACACGGTTTAGATGAA
GAGGTCCCAGAAATAAAACAATGTTGGAGTTTGGTCGGCTTCTCTGGGTTGTACTACCCT
GGAAAAATTGATGGCGAAAAGAGTTCCAGAAGTTGTCCCTTCCTCATCACCTTTAGCCTA
CAGTACTTTTGACTATTTTTTAAAATGTCTAAACATTTTTAAAAGCCACTAAATCCAGAT
AAGAACTGCATCGCCAGTCACCACAATCCCCCCCCACCCCCGCCCCAACAAATTGTATGT
CTGTGTCAGGATTTGTTCAGGGGGGCTCTGGAGACAGGCGACAAAAACCCCTGCCCTCAT
GGAGTTTGCAAACTTGCCTGATCTCTAGTTGGGGACGAGTGGGACACTTCCCTAACCTTG
GAAGCAAACAGAAGTCACACGCCTTAGCGCCTGTGAAACTTTCTTTGAGCCATTTACTCT
TTTTTTCCTCTCCAGCAGCATCCCCGAATTTTGGTTCAAGGCTGTTTGAAACTTTGCCTT
TTTTAGATCTTAATTAGGTGGAAACTTAAAGTCTTATCTGCCTTCTATGAATTGAGTTGA
AGGCTTTTTGACTGCTAAAATTAAGCTGCTAAAGAGGCAGTTTTCTTTCAACTGGTTAAA
TACTTAAGAAGGCACATAATTTCCTTTTGTTTTTTGGTAAGCAATTATCCTGGGGTTGGG
GGAGGGTAGAAGATGTTGTGTGCTTTAGATAATCTACTCATTGTCGTTCTTTAAATGTAG
GAATGAAAAAAAGATAAGCTTGAGTCATAATGCTTTTATCAAGATATACAGGTTTTACTT
TTTAAGCATTTCAGTGTCTCCAGAATTTGATTGGCCACTAGTAGATGAACTTTCTTCCTA
TACAATAGTAAGAGTATTTTCTATCCATTTGGCAGTGATTGAATCTAAGACCCCTGCTGG
GTTTACTGCATTCTTCCAACTTATTGGATAACTAGATGCTGCAAGATAACATTCCTAAAA
TTCGGGGTGGGGGTGGGGTGGAGAAATGGAAGAACTAGTTGCTGTGTAATCCCTCTGAAC
TTTGCTTTTTTTTTTTCCTTTTTGGTTAACTTAAGCATGCCCAGCAATTGTTCATAACAG
AATCTTCTTACTCCTTGGCAAATACAGTTGCGGTATTTACCAGTGGTGGCCTGGATGTAG
AAGCACTTTTTACTGCACAAGCAAACAGAGCTGCTGCTGTTTTAAGAGTCAAGTGGGATG
TTGCTGGTGGAGGCTACAGAAGAGGCAAGCTTGTGTATACAGCAAAGGCAAGCTGCTCCA
TTGATATCTTGATGATGGGGTATACCTGAGAGGACAGCAGGGAGGTGAGAACAATGAAGT
AGCTTCGAGAGACTTCCAGGCATCATGTGAAGGACCCCAGCATCTGGCTAAAACACAGTC
CCAAGTTCGGAGTTGCAATGTGTAGGCTGGCACTAACCCTAAAGTGCTCCAGTGAACCAC
CCAGGGAATGACGAGGTGGCGAGTGAGGATGAAGCCACAGTAAAGCGGCTTCGTCGGGAG
GAGACGCACGTCTGTGAGAAATGCTGTGCGGAGTTCTTCAGCATCTCTGAGTTCCTGGAA
CATAAGAAAAATTGCACTAAAAATCCACCTGTCCTCATCATGAATGACAGCGAGGGGCCT
GTGCCTTCAGAAGACTTCTCCGGAGCTGTACTGAGCCACCAGCCCACCAGTCCCGGCAGT
AAGGACTGTCACAGGGAGAATGGCGGCAGCTCAGAGGACATGAAGGAGAAGCCGGATGCG
GAGTCTGTGGTGTACCTAAAGACAGAGACAGCCCTGCCACCCACCCCCCAGGACATAAGC
TATTTAGCCAAAGGCAAAGTGGCCAACACTAATGTGACCTTGCAGGCACTACGGGGCACC
AAGGTGGCGGTGAATCAGCGGAGCGCGGATGCACTCCCTGCCCCCGTGCCTGGTGCCAAC
AGCATCCCGTGGGTCCTCGAGCAGATCTTGTGTCTGCAGCAGCAGCAGCTACAGCAGATC
CAGCTCACCGAGCAGATCCGCATCCAGGTGAACATGTGGGCCTCCCACGCCCTCCACTCA
AGCGGGGCAGGGGCCGACACTCTGAAGACCTTGGGCAGCCACATGTCTCAGCAGGTTTCT
GCAGCTGTGGCTTTGCTCAGCCAGAAAGCTGGAAGCCAAGGTCTGTCTCTGGATGCCTTG
AAACAAGCCAAGCTACCTCACGCCAACATCCCTTCTGCCACCAGCTCCCTGTCCCCAGGG
CTGGCACCCTTCACTCTGAAGCCGGATGGGACCCGGGTGCTCCCGAACGTCATGTCCCGC
CTCCCGAGCGCTTTGCTTCCTCAGGCCCCGGGCTCGGTGCTCTTCCAGAGCCCTTTCTCC
ACTGTGGCGCTAGACACATCCAAGAAAGGGAAGGGGAAGCCACCGAACATCTCCGCGGTG
GATGTCAAACCCAAAGACGAGGCGGCCCTCTACAAGCACAAGTGTAAGTACTGTAGCAAG
GTTTTTGGGACTGATAGCTCCTTGCAGATCCACCTCCGCTCCCACACTGGAGAGAGACCC
TTCGTGTGCTCTGTCTGTGGTCATCGCTTCACCACCAAGGGCAACCTCAAGGTGCACTTT
CACCGACATCCCCAGGTGAAGGCAAACCCCCAGCTGTTTGCCGAGTTCCAGGACAAAGTG
GCGGCCGGCAATGGCATCCCCTATGCACTCTCTGTACCTGACCCCATAGATGAACCGAGT
CTTTCTTTAGACAGCAAACCTGTCCTTGTAACCACCTCTGTAGGGCTACCTCAGAATCTT
TCTTCGGGGACTAATCCCAAGGACCTCACGGGTGGCTCCTTGCCCGGTGACCTGCAGCCT
GGGCCTTCTCCAGAAAGTGAGGGTGGACCCACACTCCCTGGGGTGGGACCAAACTATAAT
TCCCCAAGGGCTGGTGGCTTCCAAGGGAGTGGGACCCCTGAGCCAGGGTCAGAGACCCTG
AAATTGCAGCAGTTGGTGGAGAACATTGACAAGGCCACCACTGATCCCAACGAATGTCTC
ATTTGCCACCGAGTCTTAAGCTGTCAGAGCTCCCTCAAGATGCATTATCGCACCCACACC
GGGGAGAGACCGTTCCAGTGTAAGATCTGTGGCCGAGCCTTTTCTACCAAAGGTAACCTG
AAGACACACCTTGGGGTTCACCGAACCAACACATCCATTAAGACGCAGCATTCGTGCCCC
ATCTGCCAGAAGAAGTTCACTAATGCCGTGATGCTGCAGCAACATATTCGGATGCACATG
GGCGGTCAGATTCCCAACACGCCCCTGCCAGAGAATCCCTGTGACTTTACGGGTTCTGAG
CCAATGACCGTGGGTGAGAACGGCAGCACCGGCGCTATCTGCCATGATGATGTCATCGAA
AGCATCGATGTAGAGGAAGTCAGCTCCCAGGAGGCTCCCAGCAGCTCCTCCAAGGTCCCC
ACGCCTCTTCCCAGCATCCACTCGGCATCACCCACGCTAGGGTTTGCCATGATGGCTTCC
TTAGATGCCCCAGGGAAAGTGGGTCCTGCCCCTTTTAACCTGCAGCGCCAGGGCAGCAGA
GAAAACGGTTCCGTGGAGAGCGATGGCTTGACCAACGACTCATCCTCGCTGATGGGAGAC
CAGGAGTATCAGAGCCGAAGCCCAGATATCCTGGAAACCACATCCTTCCAGGCACTCTCC
CCGGCCAATAGTCAAGCCGAAAGCATCAAGTCAAAGTCTCCCGATGCTGGGAGCAAAGCA
GAGAGCTCCGAGAACAGCCGCACTGAGATGGAAGGTCGGAGCAGTCTCCCTTCCACGTTT
ATCCGAGCCCCGCCGACCTATGTCAAGGTTGAAGTTCCTGGCACATTTGTGGGACCCTCG
ACATTGTCCCCAGGGATGACCCCTTTGTTAGCAGCCCAGCCACGCCGACAGGCCAAGCAA
CATGGCTGCACACGGTGTGGGAAGAACTTCTCGTCTGCTAGCGCTCTTCAGATCCACGAG
CGGACTCACACTGGAGAGAAGCCTTTTGTGTGCAACATTTGTGGGCGAGCTTTTACCACC
AAAGGCAACTTAAAGGTTCACTACATGACACACGGGGCGAACAATAACTCAGCCCGCCGT
GGAAGGAAGTTGGCCATCGAGAACACCATGGCTCTGTTAGGTACGGACGGAAAAAGAGTC
TCAGAAATCTTTCCCAAGGAAATCCTGGCCCCTTCAGTGAATGTGGACCCTGTTGTGTGG
AACCAGTACACCAGCATGCTCAATGGCGGTCTGGCCGTGAAGACCAATGAGATCTCTGTG
ATCCAGAGTGGGGGGGTTCCTACCCTCCCGGTTTCCTTGGGGGCCACCTCCGTTGTGAAT
AACGCCACTGTCTCCAAGATGGATGGCTCCCAGTCGGGTATCAGTGCAGATGTGGAAAAA
CCAAGTGCTACTGACGGCGTTCCCAAACACCAGTTTCCTCACTTCCTGGAAGAAAACAAG
ATTGCGGTCAGCTAAGGGAGAACTTGCGTGGAAGGAGCAATGCAGACACAGTGAAATCTC
TAGAATCTGCTTTGTTTTGTAAGAACTCATCTCCTCCTGTTTTCTTTTTCTTACTGATAT
GCAAATGATGTTTACTACGTTGGTTGTGACCACAACCTCAGGCAAGTGCTACAATCACGA
TTGTTGCTATGCTGCTTTGCAAAAAGTTGAAAAAATAAAAAAAAAATGCATACCAAAACA
AATACAGACTCTTTTTTTTTGAGATGGAGTC

Protein Sequence

>57167 : length: 1053
MSRRKQAKPQHINSEEDQGEQQPQQQTPEFADAAPAAPAAGELGAPVNHPGNDEVASEDE
ATVKRLRREETHVCEKCCAEFFSISEFLEHKKNCTKNPPVLIMNDSEGPVPSEDFSGAVL
SHQPTSPGSKDCHRENGGSSEDMKEKPDAESVVYLKTETALPPTPQDISYLAKGKVANTN
VTLQALRGTKVAVNQRSADALPAPVPGANSIPWVLEQILCLQQQQLQQIQLTEQIRIQVN
MWASHALHSSGAGADTLKTLGSHMSQQVSAAVALLSQKAGSQGLSLDALKQAKLPHANIP
SATSSLSPGLAPFTLKPDGTRVLPNVMSRLPSALLPQAPGSVLFQSPFSTVALDTSKKGK
GKPPNISAVDVKPKDEAALYKHKCKYCSKVFGTDSSLQIHLRSHTGERPFVCSVCGHRFT
TKGNLKVHFHRHPQVKANPQLFAEFQDKVAAGNGIPYALSVPDPIDEPSLSLDSKPVLVT
TSVGLPQNLSSGTNPKDLTGGSLPGDLQPGPSPESEGGPTLPGVGPNYNSPRAGGFQGSG
TPEPGSETLKLQQLVENIDKATTDPNECLICHRVLSCQSSLKMHYRTHTGERPFQCKICG
RAFSTKGNLKTHLGVHRTNTSIKTQHSCPICQKKFTNAVMLQQHIRMHMGGQIPNTPLPE
NPCDFTGSEPMTVGENGSTGAICHDDVIESIDVEEVSSQEAPSSSSKVPTPLPSIHSASP
TLGFAMMASLDAPGKVGPAPFNLQRQGSRENGSVESDGLTNDSSSLMGDQEYQSRSPDIL
ETTSFQALSPANSQAESIKSKSPDAGSKAESSENSRTEMEGRSSLPSTFIRAPPTYVKVE
VPGTFVGPSTLSPGMTPLLAAQPRRQAKQHGCTRCGKNFSSASALQIHERTHTGEKPFVC
NICGRAFTTKGNLKVHYMTHGANNNSARRGRKLAIENTMALLGTDGKRVSEIFPKEILAP
SVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQ
SGISADVEKPSATDGVPKHQFPHFLEENKIAVS