ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5716

Name

PSMD10

Synonym

dJ889N15.2|p28|p28(GANK);proteasome (prosome, macropain) 26S subunit, non-ATPase, 10;PSMD10;proteasome (prosome, macropain) 26S subunit, non-ATPase, 10

Definition

26S proteasome non-ATPase regulatory subunit 10|26S proteasome regulatory subunit p28|ankyrin repeat protein|gankyrin|hepatocellular carcinoma-associated protein p28-II

Position

Xq22.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Autodegradation of Cdh1 by Cdh1:APC/C;PID Reactome;500401

Pathway

Apoptosis;Reactome;REACT:578

Pathway

Regulation of activated PAK-2p34 by proteasome mediated degradation;Reactome;REACT:13635

Pathway

Cell Cycle Checkpoints;Reactome;REACT:1538

Pathway

Cdc20:Phospho-APC/C mediated degradation of Cyclin A;Reactome;REACT:6850

Pathway

Signaling by Wnt;Reactome;REACT:11045

Pathway

DNA Replication;Reactome;REACT:383

Pathway

HIV Infection;Reactome;REACT:6185

Pathway

Metabolism of amino acids and derivatives;Reactome;REACT:13

Pathway

SCF(Skp2)-mediated degradation of p27/p21;PID Reactome;500372

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

External Links

Links to cell senescence gene database

5716

Links to epithelial mesenchymal transition gene database

5716

Links to ovarian cancer gene database

5716

Links to endometrial cancer gene database

5716

Links to iHOP

5716

Sequence Information

Nucleotide Sequence

>5716 : length: 1585
AGAAAAGGGAACGAGGAAGGCCGGTGATTGGTGAAGCTCTAACGGCTGTTTTGACTGGCG
TAGCCGGAGCCGGCGACGTGAGGCGGGCGTTGCTCGCGCGACAAGTAGTTGCTGGGACAG
CGAAATGGAGGGGTGTGTGTCTAACCTAATGGTCTGCAACCTGGCCTACAGCGGGAAGCT
GGAAGAGTTGAAGGAGAGTATTCTGGCCGATAAATCCCTGGCTACTAGAACTGACCAGGA
CAGCAGAACTGCATTGCACTGGGCATGCTCAGCTGGACATACAGAAATTGTTGAATTTTT
GTTGCAACTTGGAGTGCCAGTGAATGATAAAGACGATGCAGGTTGGTCTCCTCTTCATAT
TGCGGCTTCTGCTGGCCGGGATGAGATTGTAAAAGCCCTTCTGGGAAAAGGTGCTCAAGT
GAATGCTGTCAATCAAAATGGCTGTACTCCCTTACATTATGCAGCTTCGAAAAACAGGCA
TGAGATCGCTGTCATGTTACTGGAAGGCGGGGCTAATCCAGATGCTAAGGACCATTATGA
GGCTACAGCAATGCACCGGGCAGCAGCCAAGGGTAACTTGAAGATGATTCATATCCTTCT
GTACTACAAAGCATCCACAAACATCCAAGACACTGAGGGTAACACTCCTCTACACTTAGC
CTGTGATGAGGAGAGAGTGGAAGAAGCAAAACTGCTGGTGTCCCAAGGAGCAAGTATTTA
CATTGAGAATAAAGAAGAAAAGACACCCCTGCAAGTGGCCAAAGGTGGCCTGGGTTTAAT
ACTCAAGAGAATGGTGGAAGGTTAAACAGCTTGGATTTATTCTTACTTTGTATGTTGTGT
TGTTGTCCCCAGTGTCCTACAAACTAATGTATTTGTGCACAAGACATCATCTATGAATGA
TGAAGTTTTCTCACCTTCAAAGTCTTATAAACATGTTGACTCTTGTTCCTGCTGAGTTAC
TTGTTCGAAGCTTACAGCTTGTTTTCCAGGCATCGAATAACTGTTGAGATTGTTCTACTG
TTGTCGTATATTCTTCTATATTGAATTCTGGTTAATTTGGAGTAACTAATTCTGTGGCTG
TTGTGAGTCTTCAGCACCCTCCCATGTACCTTATATCCCTCTCTGAAACAGAACAGCTCC
AATAGCAACAAGCTAGTTGTTCTGCCAGATGTTTCTATGTGGATTCTGTAATGTTCCTCC
ATACAGTTAAAACATCCTAACTTGTTTTTCAAGCTCACTCAGGCCTACGCCAAACGTTTC
TGTTTTTTTTAACCATGAGGTTTAATTTATTTTTGTGATAGGAGGGATATTTACATATTT
TAGTGGACCACATTTTAAGTTGGATGGTGTGCTCTAAAATACTGAAAAACAATAGCCCAT
ATACCTATGTATTTGTTTTTGATGGGTTGTTTACTCTGAAATAAAATGTATGGTTTTCTT
AAAAGGAAGTTTTAAAGTACCTATTTTGTGTCATCCTGTATTGAAAAGAATGTCAAGCTT
GTTAAAATGACATGTAACAAAAATGTATTTTGATTTGTATTTCAGAAACTAAAAAATAAA
ATGTTGAAAGAATCAAAAAAAAAAA

Protein Sequence

>5716 : length: 226
MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLL
QLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHE
IAVMLLEGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLAC
DEERVEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMVEG