ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

57154

Name

SMURF1

Synonym

SMAD specific E3 ubiquitin protein ligase 1;SMURF1;SMAD specific E3 ubiquitin protein ligase 1

Definition

E3 ubiquitin ligase SMURF1|E3 ubiquitin-protein ligase SMURF1|SMAD-specific E3 ubiquitin-protein ligase 1|Smad ubiquitination regulatory factor 1|Smad-specific E3 ubiquitin ligase 1|hSMURF1

Position

7q22.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

estrogen responsive protein efp controls cell cycle and breast tumors growth;PID BioCarta;100182

Pathway

BMP receptor signaling;PID Curated;200123

Pathway

TGF-beta receptor signaling;PID Curated;200195

Pathway

Ubiquitin proteasome pathway;PANTHER;P00060

Pathway

Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120

Pathway

Signaling by BMP;Reactome;REACT:12034

Pathway

Signaling events mediated by HDAC Class I;PID Curated;200070

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

Signaling by TGF beta;Reactome;REACT:6844

Disease

Scleroderma;FunDO

Disease

IMMUNE;GAD

Disease

Systemic scleroderma;FunDO

Disease

Ulcerative colitis;NHGRI

Disease

Pancreas cancer;FunDO

Disease

ulcerative colitis;GAD

External Links

Links to cell senescence gene database

57154

Links to epithelial mesenchymal transition gene database

57154

Links to ovarian cancer gene database

57154

Links to endometrial cancer gene database

57154

Links to iHOP

57154

Sequence Information

Nucleotide Sequence

>57154 : length: 5781
GCGCGGCTCGGAGAGGCGGCGGCAGCGGCGGAAGCGGCGAGGGCGGCGGGCGTCCGGCTC
TGAGGTGGTGGAGGCGGCGGAGGCGGCGGCGGAGGCGGCGGCGGCTCGGGACTGGGCTCG
GCTGGAAGCAGCGAGGGTCAGAGCGCCGCAGCAAGCGCCGATCTCCCGGCTCGACCATCC
GCCTGCCGCCCGGACGCCTGGGCCGCGGAGTTTGTGTCCCGGCTCGGACCCCGGCGCCCA
GCCCGGAGCCGTAACCTTGAGGCGGCGGCGGCGGGGCCGGGCCGGGCCGGGCTGGGGGGC
GGTGGCGCTGGATCCGCGGCTGCCCGATCGTTGGCGGGAGATGTCGAACCCCGGGACACG
CAGGAACGGCTCCAGCATCAAGATCCGTCTGACAGTGTTATGTGCCAAGAACCTTGCAAA
GAAAGACTTCTTCAGGCTCCCTGACCCTTTTGCAAAGATTGTCGTGGATGGGTCTGGGCA
GTGCCACTCAACCGACACTGTGAAAAACACATTGGACCCAAAGTGGAACCAGCACTATGA
TCTATATGTTGGGAAAACGGATTCGATAACCATTAGCGTGTGGAACCATAAGAAAATTCA
CAAGAAACAGGGAGCTGGCTTCCTGGGCTGTGTGCGGCTGCTCTCCAATGCCATCAGCAG
ATTAAAAGATACCGGATACCAGCGTTTGGATCTATGCAAACTAAACCCCTCAGATACTGA
TGCAGTTCGTGGCCAGATAGTGGTCAGTTTACAGACACGAGACAGAATAGGAACCGGCGG
CTCGGTGGTGGACTGCAGAGGACTGTTAGAAAATGAAGGAACGGTGTATGAAGACTCCGG
GCCTGGGAGGCCGCTCAGCTGCTTCATGGAGGAACCAGCCCCTTACACAGATAGCACCGG
TGCTGCTGCTGGAGGAGGGAATTGCAGGTTCGTGGAGTCCCCAAGTCAAGATCAAAGACT
TCAGGCACAGCGGCTTCGAAACCCTGATGTGCGAGGTTCACTACAGACGCCCCAGAACCG
ACCACACGGCCACCAGTCCCCGGAACTGCCCGAAGGCTACGAACAAAGAACAACAGTCCA
GGGCCAAGTTTACTTTTTGCATACACAGACTGGAGTTAGCACGTGGCACGACCCCAGGAT
ACCAAGTCCCTCGGGGACCATTCCTGGGGGAGATGCAGCTTTTCTATACGAATTCCTTCT
ACAAGGCCATACATCTGAGCCCAGAGACCTTAACAGTGTGAACTGTGATGAACTTGGACC
ACTGCCGCCAGGCTGGGAAGTCAGAAGTACAGTTTCTGGGAGGATATATTTTGTAGATCA
TAATAACCGAACAACCCAGTTTACAGACCCAAGGTTACACCACATCATGAATCACCAGTG
CCAACTCAAGGAGCCCAGCCAGCCGCTGCCACTGCCCAGTGAGGGCTCTCTGGAGGACGA
GGAGCTTCCTGCCCAGAGATACGAAAGAGATCTAGTCCAGAAGCTGAAAGTCCTCAGACA
CGAACTGTCGCTTCAGCAGCCCCAAGCTGGTCATTGCCGCATCGAAGTGTCCAGAGAAGA
AATCTTTGAGGAGTCTTACCGCCAGATAATGAAGATGCGACCGAAAGACTTGAAAAAACG
GCTGATGGTGAAATTCCGTGGGGAAGAAGGTTTGGATTACGGTGGTGTGGCCAGGGAGTG
GCTTTACTTGCTGTGCCATGAAATGCTGAATCCTTATTACGGGCTCTTCCAGTATTCTAC
GGACAATATTTACATGTTGCAAATAAATCCGGATTCTTCAATCAACCCCGACCACTTGTC
TTATTTCCACTTTGTGGGGCGGATCATGGGGCTGGCTGTGTTCCATGGACACTACATCAA
CGGGGGCTTCACAGTGCCCTTCTACAAGCAGCTGCTGGGGAAGCCCATCCAGCTCTCAGA
TCTGGAATCTGTGGACCCAGAGCTGCATAAGAGCTTGGTGTGGATCCTAGAGAACGACAT
CACGCCTGTACTGGACCACACCTTCTGCGTGGAACACAACGCCTTCGGGCGGATCCTGCA
GCATGAACTGAAACCCAATGGCAGAAATGTGCCAGTCACAGAGGAGAATAAGAAAGAATA
CGTCCGGTTGTATGTAAACTGGAGGTTTATGAGAGGAATCGAAGCCCAGTTCTTAGCTCT
GCAGAAGGGGTTCAATGAGCTCATCCCTCAACATCTGCTGAAGCCTTTTGACCAGAAGGA
ACTGGAGCTGATCATAGGCGGCCTGGATAAAATAGACTTGAACGACTGGAAGTCGAACAC
GCGGCTGAAGCACTGTGTGGCCGACAGCAACATCGTGCGGTGGTTCTGGCAAGCGGTGGA
GACGTTCGATGAAGAAAGGAGGGCCAGGCTCCTGCAGTTTGTGACTGGGTCCACGCGAGT
CCCGCTCCAAGGCTTCAAGGCTTTGCAAGGTTCTACAGGCGCGGCAGGGCCCCGGCTGTT
CACCATCCACCTGATAGACGCGAACACAGACAACCTTCCGAAGGCCCATACCTGCTTTAA
CCGGATCGACATTCCACCATATGAGTCCTATGAGAAGCTCTACGAGAAGCTGCTGACAGC
CGTGGAGGAGACCTGCGGGTTTGCTGTGGAGTGAAAAGCAACCAAAGGCAACAGAGTCTA
GCTCATGGCCACCAGACCAAAAGCATCCAGCTTCTGTGCACCTCCTGCAAAGCTGGCAGA
GGCCCTGGAATTCCAGATCACCTGAGGGGAAAGGGTTGTCTCTCTCCTTTCTGTTGGGGG
AGGGGGATGGGGGACTTTTGTTGGTGGCTCCCACCCATATATCCCTCCTTTACCATAGTA
CTCCCACCCACTTCCATCACCCATCCAATAAAATGCAGCCAGGTTTAGCCTTTGGCTTTG
GTCACACAGGATATTCTGCTGTGTTGCAACCCATGTGGTGATAAGGCTCACAGCCCTGAG
CTCTTTACGGGAGCATCAACTCACAGTTAGGGGACTGGGCGTGGCTGATTGAGGGTTTGG
AACTGGTGGCTATGCCAGCTATTCCATCTCAAAACAGCCTTGAGGCCCCTTTTCAATTTG
AGCAGCTGCTAGATATCTTATCAGAGCTCAGATTCCAGATTTCACATCCCAGCAGCCGGT
TCTGGGTAGCAGATCAATTTCCAACTGGAAAATAACTATATAATGTATGCTTATTGGAAT
TCTGCCACAGCAGGAAGCTTGAGTCAAAATGTGTTTCCCCTTTGAAAGGAGAAGGAATTG
GAGCAGCTTTTCCTGGAGGCCCAGGATATTTCTTTTCTGGGTATCTTGGCTGAAAATTTT
GTTTTACATAGAGAAAAACGATCTTTTAAGGGTCCCTTTTGCTGCATTATCTGTCCAGTT
TGACTTTTTTTTCAGTGAAAACACCATGTCATGGAGTGTAGGAAAGAGCAGACCAAAATC
AGCCCTAGAGCCAACCAGTCAGTCCCAAAGCTGTGACCTCTGTGCCACTGTTGTCCATAG
AAGAGCATCGACTGTGTCACTTAAAATATTAGTAAACCATGATGCAGCAACTGCTAAGAG
CTAAACTAACAAAATTGTGTCATCATAGCTGCTGGCTTGGTGTGAACTCGCTTAAAAGCA
ATGGTGAAAGGATAACCTCGATGATGTAAATCCACCCAAAGATACTGTTCTACAAAAAGT
AGGGTGTGGACGCAAACCTGTGACAGCAGAGGGGGACGACTTCACACTCACTGCCTCATG
TGGCCCCTTTCCCAGTGGCAGCTGGTGACACTAACGATTGCTACTCGGTTCACTTGCCCA
GATGTCTTCATATGATGAGCAAGGCCAGAAGCAAGGCTAGATTCGAAGTTTCTGACACCA
TTTCCAGTTTGCACAAAAGTCAGTATTTTATCTTAAAGTGGCTTGATTTCCAATAGCTGA
ACTTGGGCAGAAAACAGCAGGCCAATGTTCCTATGTGGTTTCTTTGTTGTTGTTTTTGTT
TGGGGTGGGGGCAAGTACAGGGTAATTCATGAGCAAGACATTTCACTGCTGTCGAAGTCT
CTGGGATCCCGCTGTGGGTCTGAGATGGCCTGGGAAGGACCTTGTGGACAATGGTTTTAT
CTGTTCTTTTTGTCACTGTTAATTTCTGGGCTGCTGAGGTTCTAGAATAGAAGGGCTGCC
AAATGAGGTTTGCTGCAGGAGGAAAGTTTAATCCCCCATTCCAAAAGTCCAGGCCAAATG
GTGGGCTTAGCCTCTTTGAAAAGTTCTGCCTTGCCCCCACAGGTGGGCACATCCTGTGTC
TCATTCACCATGATGCTTCCTGAGGGTGTTCTAGAAGCCCGTTCCCCAGTGGCTGTATCC
AGCCTTTCCTTGCATCATCTTCCTCTTGAAGGTGAGGAAGTGAAAACTACAGACCTCCCC
CGGACAGCCCACTCTCTATCACGAGCCTAACCCGCGGGAGGCGGAAGAGACATCCATTCG
AGAACTGAAGCGGCCTCCGGGATGAGGTCAGAGGCCCCACCTGATTTTCCTGGTGGTGGT
ATCCAAAATCTTCAGTAACTAGGAAGGAAACCAGGGTCTCATGGTTTAAAAGACTTTGAA
GCAGGAATGTTGCATTTGACGCCTTTAAAACTACCTTTTTGCTGTTGGGAGGAGTCGGGG
GCGAGCCTTAGCAGCTGCACCGCCATCCCCATGCTGGTTGGTGCTGCCCTGCCTCTCGTG
CCGGGTGTTGCTTCAGCCCAGAGCCAGAGGGCTGGGTCCCGGGTCCTCCACAGGTGACCC
CGGTGGACACACGCGTTCCCATCCTGGCCTCCGTCTCTGCTTTTCCACTTCTACCTGCGT
GTGGGTTTGCCGCCTTGTCATCGGTTGTGTGAGTGTCGCAGACCTTTCCAGAGCTCCGGT
TCACTCTTTCCAAACAGGCCTCCCTGTCGGTGGCACTGCACTCCTAGAACCTTCAGTTTC
TACGATGGTTTGTTTGGTCCTTTTGAACCACCCCAAAGAACTCAACATGGCAAAGCAAAT
GGTAAAAGCTTCCCGACTGTTCTACTTTGGGTCCGCGCGAAGCCCACTCACGTGTGATCT
GTGTTGCCCCTCTCGGTGGTCCCAGGCGATCCAGCCATGCCCCCTGCCCCTCTGCCCAGA
TGCTTCAGGGGCCCGGCTTTTCAGGCTTGCCCTCACCAGCGGCCGTCAGCCGACACTCAG
GGATGTAGCTAACACCACTCCGCCAGTGCTTTCAGTAGGAAGAGCTGAGGCTGCCTGGGA
GGCCCGGGGCGACCGGAAAAGGGCTCTCTCAAGTTCTGAAAAGAGAATCTGCCACCAGAT
CGAATTTCGACCCCTGAGCTTGTTCGGACGTATGGTCCAAATTCAGATTAAGGTGGTCAC
CCAACCCGAGATGTCAGGAAAGGCCTTCTGCAGAGAAAATGTCCCCCCACCCGCCATCTG
CAGCCAGGTGTGTGCCACACGGCAGCCTTCCCGAAACATAGTATGGATTTTAAAAATGTG
TTTATTTTTGTTTCTCAACCACTTTATAACGTATTTTTTAATTTATTTTGTAATGTCTTG
TTTTGAAGTATTGCTGCTATCCTTGTTATCCTTCCCACTGTTTTTATCACTGATTTATTT
TGTGAAAGTTGTACACTAATGTTCTATGTCAAAATCAAAAGTATTTAATGAAATACTAGT
TCTATTTAATGTGGTTATGGAACCAGCTGGAAACACAAAACAAACAGTGATTGTACAGCA
GGCTGGGCCCAGGAGGTCAGGTTCATTTTGTTACATATGCAATAAACTCACGACTTTACA
TTTAAAAAAAAAAAAAAAAAA

Protein Sequence

>57154 : length: 774
MKSPCFLGGSVVPPSRNSRSKLTYLGRAGCWGNRTVLCAKNLAKKDFFRLPDPFAKIVVD
GSGQCHSTDTVKNTLDPKWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSN
AISRLKDTGYQRLDLCKLNPSDTDAVRGQIVVSLQTRDRIGTGGSVVDCRGLLENEGTVY
EDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQT
PQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIPSPSGTIPGGDAAFLY
EFLLQGHTSEPRDLNSVNCDELGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLHHIM
NHQCQLKEPSQPLPLPSEGSLEDEELPAQRYERDLVQKLKVLRHELSLQQPQAGHCRIEV
SREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVAREWLYLLCHEMLNPYYGLF
QYSTDNIYMLQINPDSSINPDHLSYFHFVGRIMGLAVFHGHYINGGFTVPFYKQLLGKPI
QLSDLESVDPELHKSLVWILENDITPVLDHTFCVEHNAFGRILQHELKPNGRNVPVTEEN
KKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDQKELELIIGGLDKIDLNDW
KSNTRLKHCVADSNIVRWFWQAVETFDEERRARLLQFVTGSTRVPLQGFKALQGSTGAAG
PRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAVEETCGFAVE