ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

57144

Name

PAK7

Synonym

PAK5;p21 protein (Cdc42/Rac)-activated kinase 7;PAK7;p21 protein (Cdc42/Rac)-activated kinase 7

Definition

PAK-5|PAK-7|p21(CDKN1A)-activated kinase 7|p21-activated kinase 5|p21-activated kinase 7|p21CDKN1A-activated kinase 7|protein kinase PAK5|serine/threonine-protein kinase PAK 7|serine/threonine-protein kinase PAK7

Position

20p12

Gene Type

protein-coding

Pathways and Diseases

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

Cytoskeletal regulation by Rho GTPase;PANTHER;P00016

External Links

Links to cell senescence gene database

57144

Links to epithelial mesenchymal transition gene database

57144

Links to ovarian cancer gene database

57144

Links to endometrial cancer gene database

57144

Links to iHOP

57144

Sequence Information

Nucleotide Sequence

>57144 : length: 4815
GTACGCTCATGGACAGTCCTCCGAGGGGCGAAGCCGGGCAGCTGGGCATGCTCAGTAGCT
GGGGGAGGTTTGGGTGGAGAGTAGAAAGCTGTGGCTCTGCCTCTCACCCCCTCCCGCTGG
CCCCCGCCCCCCTTGCCCCTACCCAGCCAGTAGTAGTTCCCCAGCGTGCGCCCGGGGAGA
CCGGGAACATGGCGCTGGGAGCGCTGTAGCAGCTGAGAAGGGGCTGAGGCACCGCCGCTT
CGCTGACAGCCGGCCACCAGATGTTCATGCATTCTAGAGAAAGTGGAAAACTTAGAAGCC
TAATTAATGACTGTCTTCTGGACCTCTGAGACCATGTTTCTAGTGTTTTCCGTGGAATAT
TATCAGGAAATCTAAACTCAGCAGAATCAGCTTGGACAGGTGCAGATTCATTGAAGTGAA
GAAATACACTGTGGTGAAATGCTTCCACCTCTTGCTAAAATGAACACTGAGGAAAAATGA
AGAAGACTGACAAGCACCAGCGAAAAGTTGCAGAATAGAAATAGCCACACTCCTCTGGAG
TCTTTAATTCATCCACAGCCATCATATAAAGGTTTTGGCATCATGTTTGGGAAGAAAAAG
AAAAAGATTGAAATATCTGGCCCGTCCAACTTTGAACACAGGGTTCATACTGGGTTTGAT
CCACAAGAGCAGAAGTTTACCGGCCTTCCCCAGCAGTGGCACAGCCTGTTAGCAGATACG
GCCAACAGGCCAAAGCCTATGGTGGACCCTTCATGCATCACACCCATCCAGCTGGCTCCT
ATGAAGACAATCGTTAGAGGAAACAAACCCTGCAAGGAAACCTCCATCAACGGCCTGCTA
GAGGATTTTGACAACATCTCGGTGACTCGCTCCAACTCCCTAAGGAAAGAAAGCCCACCC
ACCCCAGATCAGGGAGCCTCCAGCCACGGTCCAGGCCACGCGGAAGAAAATGGCTTCATC
ACCTTCTCCCAGTATTCCAGCGAATCCGATACTACTGCTGACTACACGACCGAAAAGTAC
AGGGAGAAGAGTCTCTATGGAGATGATCTGGATCCGTATTATAGAGGCAGCCACGCAGCC
AAGCAAAATGGGCACGTAATGAAAATGAAGCACGGGGAGGCCTACTATTCTGAGGTGAAG
CCTTTGAAATCCGATTTTGCCAGATTTTCTGCCGATTATCACTCACATTTGGACTCACTG
AGCAAACCAAGTGAATACAGTGACCTCAAGTGGGAGTATCAGAGAGCCTCGAGTAGCTCC
CCTCTGGATTATTCATTCCAATTCACACCTTCTAGAACTGCAGGGACCAGCGGGTGCTCC
AAGGAGAGCCTGGCGTACAGTGAAAGTGAATGGGGACCCAGCCTGGATGACTATGACAGG
AGGCCAAAGTCTTCGTACCTGAATCAGACAAGCCCTCAGCCCACCATGCGGCAGAGGTCC
AGGTCAGGCTCGGGACTCCAGGAACCGATGATGCCATTTGGAGCAAGTGCATTTAAAACC
CATCCCCAAGGACACTCCTACAACTCCTACACCTACCCTCGCTTGTCCGAGCCCACAATG
TGCATTCCAAAGGTGGATTACGATCGAGCACAGATGGTCCTCAGCCCTCCACTGTCAGGG
TCTGACACCTACCCCAGGGGCCCTGCCAAACTACCTCAAAGTCAAAGCAAATCGGGCTAT
TCCTCAAGCAGTCACCAGTACCCGTCTGGGTACCACAAAGCCACCTTGTACCATCACCCC
TCCCTGCAGAGCAGTTCGCAGTACATCTCCACGGCTTCCTACCTGAGCTCCCTCAGCCTC
TCATCCAGCACCTACCCGCCGCCCAGCTGGGGCTCCTCCTCCGACCAGCAGCCCTCCAGG
GTGTCCCATGAACAGTTTCGGGCGGCCCTGCAGCTGGTGGTCAGCCCAGGAGACCCCAGG
GAATACTTGGCCAACTTTATCAAAATCGGGGAAGGCTCAACCGGCATCGTATGCATCGCC
ACCGAGAAACACACAGGGAAACAAGTTGCAGTGAAGAAAATGGACCTCCGGAAGCAACAG
AGACGAGAACTGCTTTTCAATGAGGTCGTGATCATGCGGGATTACCACCATGACAATGTG
GTTGACATGTACAGCAGCTACCTTGTCGGCGATGAGCTCTGGGTGGTCATGGAGTTTCTA
GAAGGTGGTGCCTTGACAGACATTGTGACTCACACCAGAATGAATGAAGAACAGATAGCT
ACTGTCTGCCTGTCAGTTCTGAGAGCTCTCTCCTACCTTCATAACCAAGGAGTGATTCAC
AGGGACATAAAAAGTGACTCCATCCTCCTGACAAGCGATGGCCGGATAAAGTTGTCTGAT
TTTGGTTTCTGTGCTCAAGTTTCCAAAGAGGTGCCGAAGAGGAAATCATTGGTTGGCACT
CCCTACTGGATGGCCCCTGAGGTGATTTCTAGGCTACCTTATGGGACAGAGGTGGACATC
TGGTCCCTCGGGATCATGGTGATAGAAATGATTGATGGCGAGCCCCCCTACTTCAATGAG
CCTCCCCTCCAGGCGATGCGGAGGATCCGGGACAGTTTACCTCCAAGAGTGAAGGACCTA
CACAAGGTTTCTTCAGTGCTCCGGGGATTCCTAGACTTGATGTTGGTGAGGGAGCCCTCT
CAGAGAGCAACAGCCCAGGAACTCCTCGGACATCCATTCTTAAAACTAGCAGGTCCACCG
TCTTGCATCGTCCCCCTCATGAGACAATACAGGCATCACTGAGCAGAGGATTCGTGTAGG
TGGCAAAGCTAGATGAGGACATGAGAATAATTCAGGAGAACAAAAGGAAACACAGAACAT
GCAAAAGGCCTGTGCATTCTAGACCAGCCAATTGGTGGGACAGCGTGATGACCGGCAGGG
TTCAACAGACCAGGGCATCTTCTTGTGTCTTAAACAGGCATCTCTCCACTGACAGCCGGT
GTGGTCACTTGGAGCACGGCTTTAATAAGTCATTATTATATTTTTCAGCCCTTCATCCAG
CAAATCAGAAGGACTCAGTACAAACTCCGTTATGATATATCCTAGCCACATGCAGGGTAA
CATGTAGGATTTTCTATATTGAAAGAATACTTTTCTGGCAAAAAAAAAAAAAAAAGAAAG
AAAGGAAAACAAAAAGCACTTTTTTCTTAATGGTAGCAGTATAATGTATTTTGCAACGAA
TTTGTAATTTTTCTGTACGATAGTTTTGATAATTTATAGTACTTTGATGTCATGTAGCCA
TTGTATCAGTTGAAGTAATACTTGTTTACTAGAGGAGTTTGAACAAAGCCTTTCCTACTT
TTTTATCCCTTTAAGAGAACCAATGATTCTTTAGGAACTTTGAATACTGAATGACTCTCA
ATCACCGTCAGCTTTAGTAAAATCTCTTTCTTATCCTAACAAGTGTCTTATTTGGTGGAA
GAAGAATTAAGAGTGATGGTGATGGTGTGCACGTTTCATTAATCCAACCAAAAATAATGA
AATAAAATTTGAGCCACAGTATACCACTCCTTGGGATAAAGTTAAATATTTTTAAAGATC
ACATTTTCCATGAACGCCTCTAGTAGCAAACCATTCTTTTGCACACCACAATGTTTCCCT
CAGTGCCCTTTCTCAAATGGGTACAATGTTCCCTTGTGGCCAAATTTCCCTCCCAGGGAG
CAATTTCAGTGCTAGGATCATTGGATTCAGTTCCCAAAATAGAATGTTTCAGTGAGACCA
TGAGAATTCCAGGCTCACAAAGGGAGAGGAGAGAACAGGGCAAGACGTTTGGTTTCATTT
GTCACCATTTTTAAAACTCTGTATGCTAGCACACCAAACTCTTGTCTATATTTACCTTTG
TACCACAGTATTAATCGCTATTGTTCATGTATCGTGCTGGAAGTCTGAACTGACTCTAGA
GGATGAATTAGCAAGAGGGTATTTTACCAGGTATGATCTGACTTCAGTTGTGCCCATGTT
ATAATGTGTTTCCGACATAGGAGAGTCGTGCTGCTGTCTAGATCTTCTTGAATGTTGATA
AAAATGAATGACTACTACAATACATTTTGTGTTGCTTGTTGGATGAATTTGCATGTTAAC
TGTAGGCCAATATAGATTTGCCTTTAAAACTCTGGAAGAGCTACATAGTCATCATTAGTT
TCTATTAATTATGCATCAGACAAAAGCCATTTGTTACCAAACTGGGAAAACAGAGGCTTT
TCTTAACTATTTCACATACTGTAACAAATATGAATTTAAATTTGTGATAGCGCTCTGGTT
GCTCTAAGCATAATTAAGAATTTTTGTAATTAATAGGTTGCTAATTATTTATCACTGCTA
AAAAGGAAAAAAGGCATAAAATGACCTTCTACTGATTAGATTTTCAGTTTTCTTTCAAAC
TGGAAATGCCTCCATAAATATGATCTATGATTTTGCTTCATAAAACAGCAAATCAATGTT
TTATGTAAAATATTAAAGCATTAATATAAATATGTGAGAATAAAAACAATCTAAATCCAG
AAAATGGCAGTCCTAAATGTTCATGAGACAGATTGTATTAATTTAACCAGGACTATGTAG
AAGTAGAAAGAAAAGAAAAAGAAAATCTTTTTTAAACCAGAATAAACATTAAAAACTATT
GCAGAAAATAGTGGATTTTGGATTCCAAACATTTTCGACAGTGTAATGGAAATTTTTCTG
TAATTTTCTTACCATCGGGTATTTTTTAAAGTATTCATTGAGTTTACCAAAAGTTACTGT
AGCTTAAAAGGTTTTGTGAGCACTAACTATTGGCAGAAACTGCATTTGCAAATAAAAATA
AATGTTTGCCTTTTC

Protein Sequence

>57144 : length: 719
MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
PIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHA
EENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEA
YYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTA
GTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQEPMMPFG
ASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVLSPPLSGSDTYPRGPAKLPQS
QSKSGYSSSSHQYPSGYHKATLYHHPSLQSSSQYISTASYLSSLSLSSSTYPPPSWGSSS
DQQPSRVSHEQFRAALQLVVSPGDPREYLANFIKIGEGSTGIVCIATEKHTGKQVAVKKM
DLRKQQRRELLFNEVVIMRDYHHDNVVDMYSSYLVGDELWVVMEFLEGGALTDIVTHTRM
NEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKR
KSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLP
PRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH