ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

57120

Name

GOPC

Synonym

CAL|FIG|GOPC1|PIST|dJ94G16.2;golgi-associated PDZ and coiled-coil motif containing;GOPC;golgi-associated PDZ and coiled-coil motif containing

Definition

CFTR-associated ligand|Golgi associated PDZ and coiled-coil motif containing protein|Golgi-associated PDZ and coiled-coil motif-containing protein|PDZ protein interacting specifically with TC10|PDZ/coiled-coil domain binding partner for the rho-family GTP

Position

6q21

Gene Type

protein-coding

External Links

Links to cell senescence gene database

57120

Links to epithelial mesenchymal transition gene database

57120

Links to ovarian cancer gene database

57120

Links to endometrial cancer gene database

57120

Links to iHOP

57120

Sequence Information

Nucleotide Sequence

>57120 : length: 4640
ACGCATGCGCAGCGGGGGCAGGCTGGGAGGTGGGACTGACTGAGTCTTCCGTGTGTCGCC
GCCGTTGCCGCCTCAGCTTCAGCCTCGTTACTCCTGCGGTTCTGTGACTGTGCTGCTGGC
GTTAACGGCGCGAGGTGAAGGGAGGTGACGGAGTGTGCCCGCGCGCGCGGGGGTCCCCTC
AGTCCCAGCAGTTCCCTTCGTGCGCGGGGGGCGGCGAGGGTCTTCAGCAGTCGGGAGAGG
CCCTTGACGGCGCCATGTCGGCGGGCGGTCCATGCCCAGCAGCAGCCGGAGGGGGCCCAG
GGGGCGCCTCCTGCTCCGTGGGGGCCCCTGGCGGGGTATCCATGTTCCGGTGGCTGGAGG
TGCTGGAGAAGGAGTTCGACAAAGCTTTTGTGGATGTGGATCTGCTCCTGGGAGAGATCG
ATCCAGACCAAGCGGACATCACTTATGAGGGGCGACAGAAGATGACCAGCCTGAGCTCCT
GCTTTGCACAGCTTTGCCACAAAGCCCAGTCTGTGTCTCAAATCAACCACAAGCTGGAGG
CACAGTTGGTGGATCTGAAATCTGAACTGACAGAAACCCAAGCAGAGAAAGTTGTTTTGG
AGAAAGAAGTACATGATCAGCTTTTACAGCTGCACTCTATTCAGCTGCAGCTTCATGCTA
AAACTGGTCAAAGTGCTGACTCTGGTACCATTAAGGCAAAATTGTCTGGCCCCTCTGTGG
AGGAGCTGGAAAGAGAGCTTGAGGCAAACAAAAAAGAAAAAATGAAAGAAGCACAACTTG
AAGCTGAAGTGAAATTGTTGAGAAAAGAGAATGAAGCCCTTCGTAGACATATAGCTGTTC
TCCAGGCTGAAGTATATGGGGCGAGACTAGCTGCCAAGTACTTGGATAAGGAACTGGCAG
GAAGGGTCCAACAGATACAATTGCTAGGACGAGATATGAAGGGACCTGCTCATGATAAGC
TTTGGAACCAATTAGAAGCTGAAATACATTTGCATCGTCACAAAACTGTGATCCGAGCCT
GCAGAGGACGTAATGACTTGAAACGACCAATGCAAGCACCACCAGGCCATGATCAAGATT
CCCTAAAGAAAAGCCAAGGTGTTGGTCCAATTAGAAAAGTTCTCCTCCTTAAGGAAGATC
ATGAAGGCCTTGGCATTTCAATTACAGGTGGGAAAGAACATGGTGTTCCAATCCTCATCT
CTGAGATCCATCCGGGGCAACCTGCTGATAGATGCGGAGGGCTGCACGTTGGGGATGCTA
TTTTGGCAGTCAACGGAGTTAACCTAAGGGACACAAAGCATAAAGAAGCTGTAACTATTC
TTTCTCAGCAGAGAGGAGAGATTGAATTTGAAGTAGTTTATGTGGCTCCTGAAGTGGATT
CTGATGATGAAAACGTAGAGTATGAAGATGAGAGTGGACATCGTTACCGTTTGTACCTTG
ATGAGTTAGAAGGAGGTGGTAACCCTGGTGCTAGTTGCAAAGACACAAGTGGGGAAATCA
AAGTATTACAAGGATTTAATAAGAAGGCAGTAACTGACACACATGAAAATGGAGACCTGG
GCACTGCAAGTGAAACTCCGCTAGATGACGGTGCTTCAAAATTAGATGATCTGCACACTC
TGTATCATAAAAAATCTTATTAAATTGACCATATCTCCAGACAAGATTGTTAATCAGACT
ATTCTGAATTTGGGGCACTGGGGAAGATGGTGACAAAGACTACAAAATCAGGGGAGGCTG
TTTGTTGCCTAAATGAAAGGCGGGTACCTCAGGGCTTCATGTGAACAATTCTCAATGCAT
AAAACACCCTGTTTTCTGTGGTAGACCATAATTAGCTATTGCATGTAAAGCAATTTTGAT
TTTCTTGAACTTGTAAGCACCAAAGCATGTGTTTCCCAAAGGGGTATTACTGGGCTCTTA
AGTACCAAATGAAACCCTACTGTTTTACTTGGTTCCTTTTCCCTTTAGTAGGAGGACAGT
GCTAACTGGAATTTTATAAGGAGTACCCTTTAAAATACAGAGAGTAAGTGAATTCATATT
TTATATTCTAGAATGTTAACTGTGGTATTTCAGAAGACAGAGCTTGACTCAATGAATTGT
AGAAATATAGGCTTGACTTAATTTTTGTAACTGAAAGGCTTTAGACTTAAAAAAATTTAT
TGTGCATCCTAAAATCTAAACCAATTATTAATGATCATTTATTGTAATGAGTTTGCATTT
CAGCTTTATTCAATGCAGTACAAAATAGTTTTCTTTAAGCAGTCTTTTATCAATCAATGC
TGCACTAGAAATAGATTCTCAAAAGTTACTAAACATTTTACTTTTTTTGTTTTTTAAAAG
AAATGCAGATGAGTGTAAAACATCTGTTCTCAATTATGTTGATCTGTGTGCGCAGTACTG
GAGCATTTACCCATTCATGTTGAGCCTCAAATGCTTGTTTTCTGGGGTCCACAAAAGACA
GTTTTATACATTTTGAGTTGTTCATAAAGTTTGTCTTGTGATAGTCCTGGCACTTAAAGA
CAAATTTTTCTGGTAGTAAAAGTTCAGATTTATTACTATGTCATGAAACACAGTACATTC
AAATCAAACGGCAGTTTTCTTTCTAAGTAAATGATTTCCAGTCATCTAAAAGGTGGGCAA
GATGAGATAAAGACATTTTGATACAGTAATTGTTTTGGTTGGGTTTTCATGTCAGTTTAT
GTTTGACTAAAGCTCTCTTCATATGCAGGTTTATAAATTTGTTAGGTCTGTTGTCCCATG
ATTAAACATGGAGTGCCTCCTCTCTGATTTAATATTCTGCAGGTCATTGTAACCTGCTAG
GCAAAGTCACAACATTGCATTAAAGAGGTGATAGCTTTGCTAATATCACTGTTTTAAAGG
ACGTACAGTTAAAGGAATATTAAGTGGGAGAAAGCCTACAAGGCTTTTAGAATATTATCA
GTATCTTCATTTCTGGTATTCAGATGTTATGTGATAAAACACATTTTTTTTGGCTTTCCC
AGATACACTATATATTTGTTCAAGGGTAAATCTATAAAATGTATATACTTTATTTTGTGG
TTTTGCTATTTATAAATTTAATGTTTTAACTGTTGCTCATTTATGGTTTGTTTTGGGTGG
TGGTGTTCATCTGTATATCACCATGTTAATTTGTAATGGAAGTGCACTTCGTAGTGTATA
TTGTTACTGACATTAAAATACTTTATAGCATTGTCTCTGAGCAAAAGCTAGTATTTAATT
GTACAAATGAATAAGCAAGTTACATGTTATTGTTTGCTCTTGACAGGGTAGGCCTCTTAA
AAGAAAAAAAACAACTTGTTTTTTCTTTATGAATCCCCTATGCCAAACACATACCTTCCA
TGCATGACATGAGATCTGCAAACTGGATTTTAGCCACCGTATTTATTTAGTCAAAAAAAT
TGTCCATTGTAGCAGACCCGAAAACCTTTTTGCTGTGACATGAAACCATGTTATTCTTAT
CTTCTTAAAACACAGCCTGGGATGGAATGGCCATGGCATTTTTTTCAGAGAACATCCTTT
ATCTGCTATGACTGAATCCTTAGGAAATGTAAGCTATAACCCTTTGATTTTCAAGAACTA
CCGAATAAGTGTATGAAGAGGTGGTTTTTTAAAACTTCAAGTTGGAATTTTTATGAGGTC
ACTGTGTAATTTGAAGAATTGTGTGAGATTGTCATGATATAAATTCCTTTTAAGGACTGA
TAAATAGAATGAAAAGTTTCCAGGTAGTTTAAAACTCCACAGGTCAGTTTCCTTTTCATT
CCTGCTTCACTGTGGTTTATAAGCCTACGGGAGAGCACCGTTGCTCAGATGCTACTGTGA
GCTTCCTGTCCGGTGTTAGAAAGTAACTAGTTAAAAGTTCATTTTAGAATGTATGGTTTT
TGGGGATGAACTAAGAATTAGTTATTAGTTCCAAAGGACTGAGAACCAATTTTAATATTT
TCACATTTATAGGAAAGAAATTCATATGTCCCTGAAACTTCTAGGACAAAACCAAACAAG
TAAGGAGGGAACTGTTGCAAAGCCATTTCATCGAGAAGGGGACAGAAGGAGAAATACACA
CATGTATACACAAACAGAATGGTTGAGAAAACGTTTTAATAAAATGTGAGGGTTGTATGT
GTGCGTGTATATATTTACACTTAACCTCTAAAATTCTCTTCTACAGTATCTCTGTTATGA
ATATGATGGAAAAGCAACATTTTGGTGGTGAGACTATTGTTAAAATAAATTTGAGAAAGA
CGAAAATTTTGTGAGTCTTGATAATTACAAGTCAACAGCTATCGAAAGTTAGCACAGCTT
GTCTGTGGTGCTGTTTTTTTCCCCACTGCAGTGGACTTATGCTGTTTTCATGTTTAGAAA
CAAAAAGGTTTCATGTGATTCATGTGTAAGATGCACAGTATTTGACATCCTGATTATGTA
ATCCCTATTCCATCTATCCAGTCTTACACTTATGGTTGGCCTCAAATCTATTGCATTTAT
GATAATGTATTATATCTAGTTGAGTTTAATATTTTTTTATTAGCCTGTAAATAAAGATGG
CATCTTCTACATTAAAATGATATTGATCTCATTTTTTTAAATAAACATTTTGTTTCCTTG
ACGTTAAAAAAAAAAAAAAA

Protein Sequence

>57120 : length: 462
MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQA
DITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVH
DQLLQLHSIQLQLHAKTGQSADSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVK
LLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQL
EAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLG
ISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQR
GEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQG
FNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY