ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

57018

Name

CCNL1

Synonym

ANIA6A|BM-001|PRO1073|ania-6a;cyclin L1;CCNL1;cyclin L1

Definition

cyclin L ania-6a|cyclin L gamma|cyclin-L|cyclin-L1

Position

3q25.31

Gene Type

protein-coding

External Links

Links to cell senescence gene database

57018

Links to epithelial mesenchymal transition gene database

57018

Links to ovarian cancer gene database

57018

Links to endometrial cancer gene database

57018

Links to iHOP

57018

Sequence Information

Nucleotide Sequence

>57018 : length: 2951
ATTGTTGCTATGGCTTGTATTAATCTTGCATCAAAAATCGAAGAAGCACCTAGAAGAATA
AGAGATGTGATTAATGTATTCCACCACCTCCGCCAGTTAAGAGGAAAAAGGACTCCAAGC
CCCCTGATCCTTGATCAGAACTACATTAACACCAAAAATCAAGTTATCAAAGCAGAGAGG
AGGGTGCTAAAGGAGTTGGGATTTTGTGTTCATGTCAAGCATCCTCATAAGGTGAGTTGT
AGAGTACAGAAATTGGGTTCGTAAGTATTAGGACTTTTCTAAAAATTTTATTTTATATGA
ATTTATGTTTCTATCTGAGTGTTAACCTTGGTTTTAAAAAGCATTCTTTTAAAGGTTCAG
GCTTCATCGAAAAACATTCTTTTGGATGTTGAGATTTATCAGTAAAATGACAGTCAAAAA
TGTAGGTTCAAATCTTAAATCTTAATTGTGTGCTCATAGAGAAGTTATTTTTGTTTCTGT
GGTTAAAGTCCCAGTTTTTCCACCTAGAAAACAGAGATGTAAAGTTCCTCATTCCAAGGA
ATAAATGTGTAGCTACAAAAGTATCTGGCACACTTATCATCATAGTAGAATGTTCTAAGT
GTGTTGGCTGCTCACTGTTACCATTATTGGAAATTTGTTTCTCCCAACATCTCTTAGCTT
TCATTATCAATATAAGCCATAGAGTGAGTTACCCGGGTCAGGACTACCTGGGTTAGAAAT
GTACCTTGGGAAATTAGGTGAAATAATCTAGCACGGTGCCCATCACATAGTAAAGTGCCA
ATGAAAAATATTCTTTTAATTGCCTTTTTTCCTGTACAATTTTGAAATATGCTTCTAAAC
ATAATTTATATAAAATCTAGTCATGTAGCAGTTCACATTAGAATCTTATGTACATTTAAA
TTGGTCTGTATTATCGATGCACAATTAGAACTTGAGTCTAACATTTTCAATTACTTTTTT
CATTGAACTCTACTCCGAAAGAACTACCAGTATACTGAATTGAGTTTTTTTCCCTTGTCC
TTCAGATCATTGTTATGTATTTACAAGTCTTAGAATGTGAACGTAATCAAACCCTGGTTC
AAACTGCCTGGTAAGTCACTTTTTTAGATTTCTTTCCTAGCCAGGAAAACAGAAGCAGAA
ATAAAGTAAGTTTCGTTTTCCCTTTCCAAAATAATGAGATAAGTTTGTTTGGGGCTTTTC
GTTGTTTTTTTGTTTTGTTTTTTTAACCAAAAGGTAAATAATGCTTATTTCTGCTTCCTG
TTTTCTTGGCTTGACTAATTACTTTTAATGGAGAACTCAATTTAACTTTGTTCTTTTTTC
TACTCTTTAATTAAAGGGTAGTCCATGATGGTAAGTCATAGAACTCTGCCCTCTGCACTT
CAGCCCATGACCTCAGGATGGCCTGATTGGCTACCCTGCTCTCCAGCCAATCCAGTGCAA
GCTCTCATCCGAGATTCACTGAAGTGGTCCATATCCATCTGGCAGCATCTTCTAGTTCTG
TCGGGGTGTCAAAAGGATTTGTATATTTGCTTCTAGAAGAATTACATGAATGACAGTCTT
CGAACCAATGTGTTTGTTCGATTTCAACCAGAGACTATAGCATGTGCTTGCATCTACCTT
GCAGCTAGAGCACTTCAGATTCCGTTGCCAACTCGTCCCCATTGGTTTCTTCTTTTTGGT
ACTACAGAAGAGGAAATCCAGGAAATCTGCATAGAAACACTTAGGCTTTATACCAGAAAA
AAGCCAAACTATGAATTACTGGAAAAAGAAGTAGAAAAAAGAAAAGTAGCCTTACAAGAA
GCCAAATTAAAAGCAAAGGGATTGAATCCGGATGGAACTCCAGCCCTTTCAACCCTGGGT
GGATTTTCTCCAGCCTCCAAGCCATCATCACCAAGAGAAGTAAAAGCTGAAGAGAAATCA
CCAATCTCCATTAATGTGAAGACAGTCAAAAAAGAACCTGAGGATAGACAACAGGCTTCC
AAAAGCCCTTACAATGGTGTAAGAAAAGACAGCAAGAGAAGTAGAAATAGCAGAAGTGCA
AGTCGATCGAGGTCAAGAACACGATCACGTTCTAGATCACATACTCCAAGAAGACACTAT
AATAATAGGCGGAGTCGATCTGGAACATACAGCTCGAGATCAAGAAGCAGGTCCCGCAGT
CACAGTGAAAGCCCTCGAAGACATCATAATCATGGTTCTCCTCACCTTAAGGCCAAGCAT
ACCAGAGATGATTTAAAAAGTTCAAACAGACATGGTCATAAAAGGAAAAAATCTCGTTCT
CGATCTCAGAGCAAGTCTCGGGATCACTCAGATGCAGCCAAGAAACACAGGCATGAAAGG
GGACATCATAGGGACAGGCGTGAACGATCTCGCTCCTTTGAGAGGTCCCATAAAAGCAAG
CACCATGGTGGCAGTCGCTCAGGACATGGCAGGCACAGGCGCTGACTTTCTCTTCCTTTG
AGCCTGCATCAGTTCTTGGTTTTGCCTATCTACAGTGTGATGTATGGACTCAATCAAAAA
CATTAAACGCAAACTGATTAGGATTTGATTTCTTGAAACCCTCTAGGTCTCTAGAACACT
GAGGACAGTTTCTTTTGAAAAGAACTATGTTAATTTTTTTGCACATTAAAATGCCCTAGC
AGTATCTAATTAAAAACCATGGTCAGGTTCAATTGTACTTTATTATAGTTGTGTATTGTT
TATTGCTATAAGAACTGGAGCGTGAATTCTGTAAAAATGTATCTTATTTTTATACAGATA
AAATTGCAGACACTGTTCTATTTAAGTGGTTATTTGTTTAAATGATGGTGAATACTTTCT
TAACACTGGTTTGTCTGCATGTGTAAAGATTTTTACAAGGAAATAAAATACAAATCTTGT
TTTTTCTAAACTGCTTCAAATACCTTATTTAAATAAATTATTAAAAAGGAAAATTTTAAT
AGCAAAATGGC

Protein Sequence

>57018 : length: 526
MASGPHSTATAAAAASSAAPSAGGSSSGTTTTTTTTTGGILIGDRLYSEVSLTIDHSLIP
EERLSPTPSMQDGLDLPSETDLRILGCELIQAAGILLRLPQVAMATGQVLFHRFFYSKSF
VKHSFEIVAMACINLASKIEEAPRRIRDVINVFHHLRQLRGKRTPSPLILDQNYINTKNQ
VIKAERRVLKELGFCVHVKHPHKIIVMYLQVLECERNQTLVQTAWNYMNDSLRTNVFVRF
QPETIACACIYLAARALQIPLPTRPHWFLLFGTTEEEIQEICIETLRLYTRKKPNYELLE
KEVEKRKVALQEAKLKAKGLNPDGTPALSTLGGFSPASKPSSPREVKAEEKSPISINVKT
VKKEPEDRQQASKSPYNGVRKDSKRSRNSRSASRSRSRTRSRSRSHTPRRHYNNRRSRSG
TYSSRSRSRSRSHSESPRRHHNHGSPHLKAKHTRDDLKSSNRHGHKRKKSRSRSQSKSRD
HSDAAKKHRHERGHHRDRRERSRSFERSHKSKHHGGSRSGHGRHRR