ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

56980

Name

PRDM10

Synonym

PFM7;PR domain containing 10;PRDM10;PR domain containing 10

Definition

PR domain zinc finger protein 10|PR domain-containing protein 10|PR-domain family member 7|PRDM zinc finger transcription factor|tristanin

Position

11q25

Gene Type

protein-coding

External Links

Links to cell senescence gene database

56980

Links to epithelial mesenchymal transition gene database

56980

Links to ovarian cancer gene database

56980

Links to endometrial cancer gene database

56980

Links to iHOP

56980

Sequence Information

Nucleotide Sequence

>56980 : length: 7257
GCCATTATGTGAATCTCCTTTTGGCTTCTCTGCAGACTGAATAAGCGTCTCAGGATCTTC
GTCATGACTCCTAAATCTGGGCCTGTCAGTTCGCCCCAGCGTTTCTCGTCTCTAGGCACG
GCATGGGGCTTACAGAGTTTAACCAATCATATAACGTCGAGATCAGGTTGCCAGGCAGAT
TATGCTAATAAGACCCCGCCTTTTATGCTGCTCCCACTCTGCGGCGGGAAGAACCACCTG
GAGGTGGCGGGGGGGGTTGATTTCTATCACCCCTAGGGAGAGAGGATCGGGGACCCGCTG
ATCTTCCAGCTCCCCTCACCCAACGTCGTGCATGCTGCAGACAGACCTTTCCGTCCTTCA
TGAACACACGTGTGGTAGACAGATGACTGTCCTGTACCCTGTGCTGCTCTAGGTGTGCCA
GACGTGGAGCTGTCCAGTTGGGAGAAGATGGATTCCAAAGATGAAAGCTCGCATGTGTGG
CCGACATCTGCAGAGCATGAACAGAATGCCGCACAGGTGCACTTTGTTCCGGACACAGGA
ACAGTGGCTCAGATTGTCTATACCGATGACCAGGTTCGCCCCCCACAGCAGGTGGTGTAC
ACGGCAGATGGTGCCTCCTACACATCAGTGGATGGTCCAGAGCACACGCTGGTGTACATC
CACCCGGTGGAAGCTGCACAGACTCTGTTTACAGACCCCGGCCAGGTAGCTTATGTCCAA
CAGGATGCTACAGCTCAGCAGGAGACTGACTTCAGCATGATGAAACAAACAGGCACCTCA
TCTCTTTCATTCTTACTTAAAAACCTCAGCCTGCCTGAGCTGTTTAAAAGGAGAGCTGTG
AGCTATGGAACTTTGTTAACCATGTGTTGCACGACGTGTTTAGTTTTAAAAGACAAGTGG
TTGAGGATAGGTCAACTCATTTACCCCCTCCAGTGTGGTATGGCTACTCTGGAAAGGCAA
GAGGGACCCCCACCCCAGGTTTAGTTCAGATGTGGAAACTGATGATACCTCACATGTGCA
CACATCGAAACGGTCTGTTGCTTACCTATTTGAAGTCTTGGGAGACAGGGCAGGCCTCTC
AAGCAGTGTGAAACGGCTGAATGAGCCAGGAAGAGACCAGGTTTTATTAAGTTTTAGGGG
TGGGGTCAGGACGCAGGTGGTCAGGGCCTTGCCAGTGTTGACTCTCCCACTGCTGCCAAA
GGAGGGAGCACCTGAGCCTTCTTAGCAGCCCTCCCAGGTGTGGGACAGAAGGGGCAGAGG
GAGGGCAGAGGCTTAAAGGCTGTGAGCAGTCAGATCAAAAATGAAGCCAGCTCTTCCTCA
CAGCCGGTAGATGGAAGTCATTTTTCCAGGGCCTGGAAGGAGTTGGTAGGAAGACTAGAT
TTCAGCCAGCCCTTGCGCCCTGTTTGTGCCAGCAGGCACCAGCGAACCAAAAGCAGGTGT
CCATGTCTGCTTACTCTGTGCCTTCAACTTTTGCCCAGGCCTCATTGCCAGTTCATAACC
AGGTGCTGCCTTCCATCGAGAGTGTAGATGGGTCCGACCCTTTGGCAACTCTGCAGACCC
CTCTAGGCAGACTGGAGGCCAAAGAGGAAGAGGATGAGGATGAGGACGAGGACACTGAGG
AAGATGAGGAAGAAGACGGTGAGGACACGGATCTGGATGACTGGGAGCCAGACCCGCCCC
GGCCCTTCGACCCACACGACTTGTGGTGTGAGGAGTGCAATAACGCGCATGCTTCAGTGT
GTCCGAAGCACGGCCCCTTGCACCCGATCCCCAACCGGCCGGTGCTCACCCGGGCCAGGG
CGAGCCTCCCCCTGGTGCTCTACATAGACAGGTTTCTGGGCGGGGTGTTCTCCAAGCGGC
GCATCCCCAAGCGCACCCAGTTTGGCCCCGTGGAGGGGCCTCTCGTCAGGGGCTCGGAGC
TGAAAGACTGTTACATTCACCTCAAGGTTTCTCTTGATAAAGGGGACAGGAAAGAAAGGG
ATTTACATGAAGACCTATGGTTTGAGTTGTCTGATGAGACGCTTTGTAACTGGATGATGT
TTGTACGGCCAGCCCAGAATCACCTGGAGCAGAACCTGGTGGCTTACCAGTATGGCCACC
ATGTGTATTATACAACCATAAAAAATGTGGAGCCCAAGCAGGAACTGAAGGTGTGGTATG
CCGCATCCTATGCTGAGTTCGTGAACCAGAAAATTCATGACATTTCTGAGGAAGAAAGGA
AAGTTCTTCGAGAGCAAGAGAAGAATTGGCCCTGCTATGAATGTAACCGCCGATTTATAA
GCTCGGAGCAGTTGCAACAGCATCTCAATTCTCATGATGAGAAACTAGATGTGTTTAGCA
GAACAAGAGGCAGAGGAAGGGGACGAGGCAAGAGGCGATTCGGTCCAGGTCGACGGCCGG
GGCGTCCTCCAAAATTTATCCGCCTGGAAATCACCAGCGAAAATGGGGAAAAGAGTGACG
ATGGGACACAGGACTTGCTACATTTTCCCACAAAGGAGCAATTTGATGAGGCTGAACCAG
CCACTCTGAATGGGCTGGATCAACCAGAACAGACCACTATCCCAATCCCTCAGCTGCCAC
AGGAAACCCAGTCTTCCCTGGAACATGAACCAGAAACTCACACCCTGCACCTGCAGCCGC
AGCATGAAGAGAGCGTGGTGCCCACCCAGAGCACGCTGACAGCCGACGACATGCGCAGAG
CCAAGCGCATCCGAAATGCAGCTCTTCAGCATCTGTTTATTCGGAAGTCCTTCCGGCCTT
TTAAATGCTTGCAGTGTGGGAAGGCCTTCCGGGAAAAGGACAAACTGGACCAGCACTTAC
GCTTCCATGGGCGGGAGGGGAACTGCCCACTGACCTGTGATCTCTGTAACAAGGGCTTCA
TCAGCAGCACATCCTTGGAGAGCCACATGAAGCTCCACTCAGACCAGAAGACTTACTCTT
GCATTTTTTGCCCAGAATCCTTTGACCGCCTTGATTTGTTGAAAGATCATGTGGCCATTC
ATATCAATGATGGCTACTTCACCTGCCCAACTTGTAAGAAACGGTTCCCAGATTTTATCC
AGGTGAAAAAACACGTGCGCAGCTTCCACTCAGAAAAGATCTACCAGTGCACAGAGTGTG
ACAAGGCCTTCTGTCGCCCCGATAAACTGCGACTCCACATGCTCCGGCATTCGGACCGCA
AAGACTTCCTGTGTTCCACCTGTGGGAAGCAATTTAAGCGAAAAGACAAACTACGGGAAC
ACATGCAGAGGATGCATAATCCTGAGAGGGAGGCCAAGAAAGCCGACCGCATCAGCCGCT
CCAAGACGTTCAAGCCCCGCATCACGTCCACAGACTACGACAGCTTCACGTTCAAGTGCC
GCCTGTGCATGATGGGCTTCCGGCGGCGCGGCATGCTGGTAAATCACTTATCGAAGAGAC
ACCCAGACATGAAGATAGAAGAGGTGCCAGAGTTAACTCTACCCATCATAAAACCCAATC
GTGATTACTTTTGTCAGTATTGCGATAAGGTTTATAAAAGTGCCAGCAAGCGCAAAGCCC
ACATTCTGAAGAACCACCCAGGAGCAGAGCTCCCACCGAGCATTCGGAAGCTCCGACCCG
CTGGTCCTGGAGAGCCAGACCCCATGCTGAGCACACACACCCAGCTGACGGGCACCATCG
CCACCCCTCCCGTCTGCTGTCCCCACTGCTCCAAGCAGTACAGCAGCAAGACCAAGATGG
TCCAGCACATTCGAAAGAAGCATCCAGAGTTCGCCCAGCTCTCCAACACCATACACACAC
CACTGACGACAGCTGTGATCAGTGCCACCCCAGCGGTTTTGACTACAGACAGCGCCACTG
GAGAGACTGTGGTGACGACGGACCTGCTCACCCAAGCAATGACAGAACTGTCCCAGACCT
TAACGACAGACTACCGAACGCCACAAGGGGATTACCAGAGAATTCAGTACATCCCTGTGT
CGCAGTCGGCGTCTGGCCTCCAGCAGCCTCAGCACATACAGCTGCAAGTGGTTCAAGTGG
CCTCGGCCACTTCCCCTCACCAGTCACAGCAGTCCACTGTGGATGTTGGCCAGCTCCATG
ATCCTCAGCCCTACCCCCAGCACGCCATCCAGGTGCAGCACATCCAGGTCAGCGAGCCTA
CCGCCTCGGCCCCGTCCTCCGCCCAGGTATCTGGGCAGCCGTTGAGTCCCTCAGCCCAGC
AGGCTCAGCAGGGGCTCAGCCCCTCCCACATCCAGGGCAGTTCTTCCACACAGGGGCAGG
CTCTGCAGCAGCAGCAGCAGCAGCAGCAGAATTCCTCTGTGCAGCACACGTACCTGCCCA
GTGCTTGGAATTCCTTCCGTGGCTATTCATCTGAGATTCAAATGATGACGCTTCCTCCGG
GTCAGTTTGTGATTACAGACAGTGGTGTGGCAACTCCAGTTACTACTGGCCAGGTGAAGG
CGGTTACTTCGGGTCATTATGTGTTATCAGAAAGTCAATCAGAATTGGAAGAAAAGCAAA
CTTCTGCCCTCTCTGGTGGAGTCCAGGTCGAGCCACCTGCACACAGTGACTCCCTGGACC
CCCAGACCAACAGCCAACAGCAGACCACACAGTACATCATCACCACCACCACCAACGGGA
ACGGAAGCAGCGAAGTGCATATCACCAAACCATGACTTCCACCCTGGAGCTTGAATCCAG
CACCCACCTCATGTCTGTTCTCATAAGTCTGAAAGCTCTGACACGTAGAGCTCTTTTGTA
AGATTTATTATTCACTCAAGAGTTCGGAAACCACAGTTTTGTCTCTCATCCATACACTGG
GGTTTATTTTGCCAAGGTCATCTTTATCAAATTGACTCTTCAAACCCTCGGTTTTTGCCA
CAGAACAGAGATCTTTCAGGGGAAAGTAGATTTCGAGGTGGAGAGAATTTGCCTTGCTCT
TGAGCTGGTCTTTTAACATACTGACGAGCCTTACTTTTCCTTTGTGGAAATATTAAGTGG
CATATTGTGTTCATACCAAAGGTGGAGACAGGATGTGCCAAGTTCATGGTTACTGGACTT
CTTATTCCAAGCCATGGCACCAAAGGAGAAGGGGCATTTTGTGGGTGTGCATTAGGTCTG
AACTGCTTTATCTTGTTTTAGTTTTCAGTAATTTAACAAAGGGAGCCTGCTGAATAACAA
AATTAAAATGATGAAACAAAAGTTTGACAGTGATATTCTGAAGCAAAAACTGTCATCTAA
ATTTTTCTTGCTGATTTTTTTTAACTTCCCTATTTTAGAAAACTATTGTTGGGCTGTTGG
TAGTGCTTTCCACAGATGCTGGTCCTCAGTGGATTAGGTCAGAAGCTCATGTTCTGATAG
TTCTTCATTATTTCACAAAGGTGGACAACCTGAAAGAGAAAAGGCTGCTTGATGTCAGCA
GAATCTAAACCCCTACATTAAAGCTTTGCCTCCCATTCTGTGGTTGTGGTGGTGGTAAGA
AGGAGATATTGGTACCAAGAAAAATTTCCAAAACTATTGAGAGAGAGAGAGAGAAAGTAT
TGAAATTTTGTTCTGCCTTGCAGGATCCATTTATCATTCATTGGTAAAGGATATATTCCT
TGTTCTTACCAAGTGTACATTTAACTCTTGCTGACATGTTCAGTGTATTTTATTACTTTT
AATGCTGTCTTAAAATGAACATTCTTTAAAGTTGGACAGGAAGGTGGCATTTCTTATTTA
TTAACATTTTTAACTTTAAACATATTGTGACTCATCTAGACCTTTTAATAAGACGGTCAA
CTTCACACTTAGGGAAAAAATTAAAATGTGATGGCCACTTCTAATAATTCAGGTAGTTAT
AAGGGATCTGGAAGAAATCCAGTCTTTATGAATATACTATTAGTTGGGCATTAAAAAATC
AGTATATATTTTAACTTTTTGTGACATGCTAACACATTTTCAGAATAATTATTGCATAGT
AGAATTTATTACTCCAGAACAGAAAGACCTTACTTCATTTCAAATGAAGTTAATTAATTT
ACATTTCTGGGTAAAAACTGGTTCTATAAATTAAGTAGAGTAGCTTCTTTATGATAAAGA
CAATTTTCTGAAAAGTGAACAATTCTGTTAAAAGAACTTTATTGATGTGTAGATTTCGCA
CTTTATTTCTGAGACTGCGTTCATGTAGTTGTTCCCCAATGTTTGAGTACTAAGAGAACT
TGAGAAAATTACTTCATAAACATATGGAAACTGAAAATGGACTCTCTTTGTGACAAAGAT
ATTCAACAGAAAATATTGACCCTGCATTGCAAAACACAGGTTCGGGTTCCCTAAGTCCCA
CAGTGTAATGATTACAAATATCCTAGTGTCCGGTCTAGAAAGACTTTCTAGGAGAAGACT
AGTGGAATTTTCTAAAGGTTCAGTTTTAGCTTTTATAACTTAAATTTGGCCCTGTTACGT
TCTTTTTAATTTGAACCATAAGGTATCTCCCCTCCCTTCAGGAATAACTTATTGGAAAAC
TGAAAAGAATCACTGAATGGAATGTTCATTTTATGGCAGTTGTTTTAAGTTTTAAAATAC
ACAGAGGAAAATATTGTGGAAGGACCTCTTTGTTGCTTTCCCTTCTAAGTTGTCTTCTTC
TTCTTCTTCTTCTTCTTCTTCTTTGGTCCTTAAGTGAAATAAAGACTCTAAAACTAATTT
GTATATTATCAGCCAGAGATGCGGATGGCAGTCGAGCCAAATCGCATGGCTTTCAGATCA
GGTATTCTGCACATTCATTCCAAGGTCATAGATTTTTAAAAGGACCTGGATTTGAAGAGA
TGGCAAATGATGAGCCATCAGAAAACTTAATTTGGAAAACATGTATGTAGCCAGTGTGGA
TATTGTGGCCTCTCTCAAGACACATTGACACTGTAGACTTCATTCAGTCCAGTGTGAGTA
TTTTGGAGTAGGTTGGATGTAGATTTTGTTTTTATCATTGATTTGTACCGACAGAAATAG
ACATTTCATCATGTAAAATTCCTGTTATTCTGGAAAAACCTATTGTTTTGATCTTCTTGT
TTTCTGACTTGGAAGTATCCTTTCAAAAAAACTCTTAAGATATCTAGGTCTAAAAAGCAC
TTCATGAGATGCTAAAGCTGACCCACTGGTTGAAAATGTTGACCCTATCCTGTTATTTAA
ATGTGAACATTTATTGTACATTCAGTGAGTTATAGTGTTAATAGTCTTGTGCTATGCAGC
AGGTGTAAAAATTAATAAATATATTTTTTAATAAACATGTTTGTATGTGTGAAGCTA

Protein Sequence

>56980 : length: 1160
MDSKDESSHVWPTSAEHEQNAAQVHFVPDTGTVAQIVYTDDQVRPPQQVVYTADGASYTS
VDGPEHTLVYIHPVEAAQTLFTDPGQVAYVQQDATAQQASLPVHNQVLPSIESVDGSDPL
ATLQTPLGRLEAKEEEDEDEDEDTEEDEEEDGEDTDLDDWEPDPPRPFDPHDLWCEECNN
AHASVCPKHGPLHPIPNRPVLTRARASLPLVLYIDRFLGGVFSKRRIPKRTQFGPVEGPL
VRGSELKDCYIHLKVSLDKGDRKERDLHEDLWFELSDETLCNWMMFVRPAQNHLEQNLVA
YQYGHHVYYTTIKNVEPKQELKVWYAASYAEFVNQKIHDISEEERKVLREQEKNWPCYEC
NRRFISSEQLQQHLNSHDEKLDVFSRTRGRGRGRGKRRFGPGRRPGRPPKFIRLEITSEN
GEKSDDGTQDLLHFPTKEQFDEAEPATLNGLDQPEQTTIPIPQLPQETQSSLEHEPETHT
LHLQPQHEESVVPTQSTLTADDMRRAKRIRLELQNAALQHLFIRKSFRPFKCLQCGKAFR
EKDKLDQHLRFHGREGNCPLTCDLCNKGFISSTSLESHMKLHSDQKTYSCIFCPESFDRL
DLLKDHVAIHINDGYFTCPTCKKRFPDFIQVKKHVRSFHSEKIYQCTECDKAFCRPDKLR
LHMLRHSDRKDFLCSTCGKQFKRKDKLREHMQRMHNPEREAKKADRISRSKTFKPRITST
DYDSFTFKCRLCMMGFRRRGMLVNHLSKRHPDMKIEEVPELTLPIIKPNRDYFCQYCDKV
YKSASKRKAHILKNHPGAELPPSIRKLRPAGPGEPDPMLSTHTQLTGTIATPPVCCPHCS
KQYSSKTKMVQHIRKKHPEFAQLSNTIHTPLTTAVISATPAVLTTDSATGETVVTTDLLT
QAMTELSQTLTTDYRTPQGDYQRIQYIPVSQSASGLQQPQHIQLQVVQVASATSPHQSQQ
STVDVGQLHDPQPYPQHAIQVQHIQVSEPTASAPSSAQVSGQPLSPSAQQAQQGLSPSHI
QGSSSTQGQALQQQQQQQQNSSVQHTYLPSAWNSFRGYSSEIQMMTLPPGQFVITDSGVA
TPVTTGQVKAVTSGHYVLSESQSELEEKQTSALSGGVQVEPPAHSDSLDPQTNSQQQTTQ
YIITTTTNGNGSSEVHITKP