ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

56979

Name

PRDM9

Synonym

MEISETZ|MSBP3|PFM6|PRMD9|ZNF899;PR domain containing 9;PRDM9;PR domain containing 9

Definition

PR domain zinc finger protein 9|histone-lysine N-methyltransferase PRDM9|minisatellite binding protein 3 (115kD)|minisatellite binding protein 3, 115kDa

Position

5p14

Gene Type

protein-coding

External Links

Links to cell senescence gene database

56979

Links to epithelial mesenchymal transition gene database

56979

Links to ovarian cancer gene database

56979

Links to endometrial cancer gene database

56979

Links to iHOP

56979

Sequence Information

Nucleotide Sequence

>56979 : length: 3691
CTCTGAGAGAACGCCCGGCCAGGGTGAACGCCGCGGCAGGAGAGCACGGGAGACTGTGAA
GAGCATGGGGAGCCTTTGTCGTGCAGCGTGAAACCCTTGAGCCTTTGGCCTAGGAGCTGG
GAGACTCAGGGCCCTTCTCACACTCAGAATTGGAGCAGGGCCTTCTAGACAGTCCCAGCA
CCATGAGCCCTGAAAAGTCCCAAGAGGAGAGCCCAGAAGAAGACACAGAGAGAACAGAGC
GGAAGCCCATGGTCAAAGATGCCTTCAAAGACATTTCCATATACTTCACCAAGGAAGAAT
GGGCAGAGATGGGAGACTGGGAGAAAACTCGCTATAGGAATGTGAAAAGGAACTATAATG
CACTGATTACTATAGGTCTCAGAGCCACTCGACCAGCTTTCATGTGTCACCGAAGGCAGG
CCATCAAACTCCAGGTGGATGACACAGAAGATTCTGATGAAGAATGGACCCCTAGGCAGC
AAGTCAAACCTCCTTGGATGGCCTTAAGAGTGGAACAGCGTAAACACCAGAAGGGAATGC
CCAAGGCGTCATTCAGTAATGAATCTAGTTTGAAAGAATTGTCAAGAACAGCAAATTTAC
TGAATGCAAGTGGCTCAGAGCAGGCTCAGAAACCAGTGTCCCCTTCTGGAGAAGCAAGTA
CCTCTGGACAGCACTCAAGACTAAAACTGGAACTCAGGAAGAAGGAGACTGAAAGAAAGA
TGTATAGCCTGCGAGAAAGAAAGGGTCATGCATACAAAGAGGTCAGCGAGCCGCAGGATG
ATGATTACCTCTATTGTGAGATGTGTCAGAACTTCTTCATTGACAGCTGTGCTGCCCATG
GGCCCCCTACATTTGTAAAGGACAGTGCAGTGGACAAGGGGCACCCCAACCGTTCAGCCC
TCAGTCTGCCCCCAGGGCTGAGAATTGGGCCATCAGGCATCCCTCAGGCTGGGCTTGGAG
TATGGAATGAGGCATCTGATCTGCCGCTGGGTCTGCACTTTGGCCCTTATGAGGGCCGAA
TTACAGAAGACGAAGAGGCAGCCAACAATGGATACTCCTGGCTGATCACCAAGGGGAGAA
ACTGCTATGAGTATGTGGATGGAAAAGATAAATCCTGGGCCAACTGGATGAGGTATGTGA
ACTGTGCCCGGGATGATGAAGAGCAGAACCTGGTGGCCTTCCAGTACCACAGGCAGATCT
TCTATAGAACCTGCCGAGTCATTAGGCCAGGCTGTGAACTGCTGGTCTGGTATGGGGATG
AATACGGCCAGGAACTGGGCATCAAGTGGGGCAGCAAGTGGAAGAAAGAGCTCATGGCAG
GGAGAGAACCAAAGCCAGAGATCCATCCATGTCCCTCATGCTGTCTGGCCTTTTCAAGTC
AGAAATTTCTCAGTCAACATGTAGAACGCAATCACTCCTCTCAGAACTTCCCAGGACCAT
CTGCAAGAAAACTCCTCCAACCAGAGAATCCCTGCCCAGGGGATCAGAATCAGGAGCAGC
AATATCCAGATCCACACAGCCGTAATGACAAAACCAAAGGTCAAGAGATCAAAGAAAGGT
CCAAACTCTTGAATAAAAGGACATGGCAGAGGGAGATTTCAAGGGCCTTTTCTAGCCCAC
CCAAAGGACAAATGGGGAGCTGTAGAGTGGGAAAAAGAATAATGGAAGAAGAGTCCAGAA
CAGGCCAGAAAGTGAATCCAGGGAACACAGGCAAATTATTTGTGGGGGTAGGAATCTCAA
GAATTGCAAAAGTCAAGTATGGAGAGTGTGGACAAGGTTTCAGTGTTAAATCAGATGTTA
TTACACACCAAAGGACACATACAGGGGAGAAGCTCTACGTCTGCAGGGAGTGTGGGCGGG
GCTTTAGCTGGAAGTCACACCTCCTCATTCACCAGAGGATACACACAGGGGAGAAGCCCT
ATGTCTGCAGGGAGTGTGGGCGGGGCTTTAGCTGGCAGTCAGTCCTCCTCACTCACCAGA
GGACACACACAGGGGAGAAGCCCTATGTCTGCAGGGAGTGTGGGCGGGGCTTTAGCCGGC
AGTCAGTCCTCCTCACTCACCAGAGGAGACACACAGGGGAGAAGCCCTATGTCTGCAGGG
AGTGTGGGCGGGGCTTTAGCCGGCAGTCAGTCCTCCTCACTCACCAGAGGAGACACACAG
GGGAGAAGCCCTATGTCTGCAGGGAGTGTGGGCGGGGCTTTAGCTGGCAGTCAGTCCTCC
TCACTCACCAGAGGACACACACAGGGGAGAAGCCCTATGTCTGCAGGGAGTGTGGGCGGG
GCTTTAGCTGGCAGTCAGTCCTCCTCACTCACCAGAGGACACACACAGGGGAGAAGCCCT
ATGTCTGCAGGGAGTGTGGGCGGGGCTTTAGCAATAAGTCACACCTCCTCAGACACCAGA
GGACACACACAGGGGAGAAGCCCTATGTCTGCAGGGAGTGTGGGCGGGGCTTTCGCGATA
AGTCACACCTCCTCAGACACCAGAGGACACACACAGGGGAGAAGCCCTATGTCTGCAGGG
AGTGTGGGCGGGGCTTTAGAGATAAGTCAAACCTCCTCAGTCACCAGAGGACACACACAG
GGGAGAAGCCCTATGTCTGCAGGGAGTGTGGGCGGGGCTTTAGCAATAAGTCACACCTCC
TCAGACACCAGAGGACACACACAGGGGAGAAGCCCTATGTCTGCAGGGAGTGTGGGCGGG
GCTTTCGCAATAAGTCACACCTCCTCAGACACCAGAGGACACACACAGGGGAGAAGCCCT
ACGTCTGCAGGGAGTGTGGGCGGGGCTTTAGCGATAGGTCAAGCCTCTGCTATCACCAGA
GGACACACACAGGGGAGAAGCCCTACGTCTGCAGGGAGGATGAGTAAGTCATTAGTAATA
AAACCTCATCTCAATAGCCACAAAAAGACAAATGTGGTCACCACACACTTGCACACCCCA
GCTGTGAGGTGGCTTCAGCGGAAGTCTGCTGACCCCTTATATTCCCCGAGAGTATAAAGA
GATCGGAAATAACTGATTAAACAAATCCGCCACTTTCATGACTAGAGATGAGGAAGAACA
AGGGATAGTTCTGTAAGTGTTCGGGGGACATCAGCATGTGTGGTTCTTTCCCGCACTGAT
CCCCTCCATTTTTTGTTTGTTTTTTTGCCTCCTGTTCTAATAAATTTTGTCTCCATACAA
ATCTGAACCCCAAGTGTGTACCTCATTCTTCCCTTATCACTGAAGGCAAGAAGAGTCCAG
AAGGGCCACAGAGAACTCATGTGTTCAGCTCAAGACTCCACAGGAATTCAACCCCCAGAA
AGACATAAACTTGGAGTCCGTCTGGTTTAATTATTGGAGAATCGATTCCCAAGTCCAGGA
AGAGAAATGTAAGATTCTAGAAAGTCGCAGCAGGAAAGGGAGTTCCCTGGTCTCCTGGGA
AGTGTGGCTTCTTCTCCTAATGGACACCTCTCCTCTGCTGCCATACTCTCCCTTGGCTCC
CCAGTCTCCTCTCCTGATCTCCTCCAATCTCTGTAGCCCAAGATGTGAAAGCCAGACAAG
AACACGCGTGTGTGTATATATGTGTTCGGGTGTGGGGGTATGTGCCCTCCGTGTAGGTAA
CTGTGTGAGTGTGGGGGGTTTCAAGGGTGTGTTAGGAACAACGCTCAAAATCCTAAGGAA
ACTGAACACTCGAACGAAGGATTCTTAGCAA

Protein Sequence

>56979 : length: 894
MSPEKSQEESPEEDTERTERKPMVKDAFKDISIYFTKEEWAEMGDWEKTRYRNVKRNYNA
LITIGLRATRPAFMCHRRQAIKLQVDDTEDSDEEWTPRQQVKPPWMALRVEQRKHQKGMP
KASFSNESSLKELSRTANLLNASGSEQAQKPVSPSGEASTSGQHSRLKLELRKKETERKM
YSLRERKGHAYKEVSEPQDDDYLYCEMCQNFFIDSCAAHGPPTFVKDSAVDKGHPNRSAL
SLPPGLRIGPSGIPQAGLGVWNEASDLPLGLHFGPYEGRITEDEEAANNGYSWLITKGRN
CYEYVDGKDKSWANWMRYVNCARDDEEQNLVAFQYHRQIFYRTCRVIRPGCELLVWYGDE
YGQELGIKWGSKWKKELMAGREPKPEIHPCPSCCLAFSSQKFLSQHVERNHSSQNFPGPS
ARKLLQPENPCPGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPP
KGQMGSCRVGKRIMEEESRTGQKVNPGNTGKLFVGVGISRIAKVKYGECGQGFSVKSDVI
THQRTHTGEKLYVCRECGRGFSWKSHLLIHQRIHTGEKPYVCRECGRGFSWQSVLLTHQR
THTGEKPYVCRECGRGFSRQSVLLTHQRRHTGEKPYVCRECGRGFSRQSVLLTHQRRHTG
EKPYVCRECGRGFSWQSVLLTHQRTHTGEKPYVCRECGRGFSWQSVLLTHQRTHTGEKPY
VCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRGFRDKSHLLRHQRTHTGEKPYVCRE
CGRGFRDKSNLLSHQRTHTGEKPYVCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRG
FRNKSHLLRHQRTHTGEKPYVCRECGRGFSDRSSLCYHQRTHTGEKPYVCREDE