ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

56978

Name

PRDM8

Synonym

PFM5;PR domain containing 8;PRDM8;PR domain containing 8

Definition

PR domain zinc finger protein 8|PR domain-containing protein 8|PR-domain containing protein 8

Position

4q21

Gene Type

protein-coding

External Links

Links to cell senescence gene database

56978

Links to epithelial mesenchymal transition gene database

56978

Links to ovarian cancer gene database

56978

Links to endometrial cancer gene database

56978

Links to iHOP

56978

Sequence Information

Nucleotide Sequence

>56978 : length: 4163
CAGGCGAAGGGCGGGGAAGGAGGAGCCTGAGCGTTCCGGTACCCAACCCTCTCTCTTTCT
TGACCTTCCTCCCCTCTGCCCCTTCATCCTGGGCGCGGAGGGCGGAACAGTTTCTGGACC
AGAGCACCCGCGAGAAGCAGGGAGCGGCCGCACAGCAGCCAGAAGAGGGCGCCAGCACCC
CGGGGCCGGGGCTACAGGGCTGGCTCTGCCCCGGCGTCCCGCCCCCGCCCCGGGGAACGC
TGCCTCTGCCGCAAAGATGCCCCCTTCCGCTGGAAAGCGGTGCCTCCCTGGGTGCTCGCG
AAAGCAGCCCTGAGAATGGCAGCTCTCAGAGGTTGAAGTCATTCTTTTCGGGGGACGGGG
CACGGCGACTGTTTGATTGGGGGACTTGTTTTCCTACAATTTCACAAAAAGCCTCGCTAG
AGGAATGTGCAAGGACAGAAGGGAAACTGAGGAGACCCGCAACTCATTAGCGAAATAATA
GGGTGCACTTCAATAAAAATGCGGTCCTGAAGTGGAGCAGACTCACCGGCAAGGAGCCCG
GAAAATCGTCAGGGGCGGCGGCAAAATACTATCAAATCAGCCTGGGAAGCATCTTTTCGC
TCAGCAAGTTCAAGAGAACAAATATGTTACAATCCTTGCCTATTCTTGCCTCCACTTCAT
AATGTCATAAAAGCCACCTGGGGTGTCATTTATCAACCTCTCTCCAGCCCACTCTTCCAA
AATAACACTACAGTTTCCTACATGTGTATTTTTGCCAGGACTCCAAAGAGCCTTGCTAAA
GTGGAACAAGCAAAATCCTCCCCTGGCCTCCTGGGACTGCAGTCACCAGGCTGTCAAAGC
CTCAATACCCCACTGAGTTCCAGAGAAGGGTCTCAAAGCTGGGAGAGGATCAAACTAACA
TGGAGTAGAGAATTGAACTGTGAAAAAGAAGCCCGAGATTCCCCAGCGACGTGGTGTTGC
AGCCCCGTTGAAGGAGTCAACTTGCAGGCTGTTAAAGACCTCAAGTCATTAGCATCAGCT
GCTGCACTAAAGGGGCAAGTCAGCGCCTCTAAGTGGCTTAGCGCACAAACGAGGCTCCCG
AGACGGCCTCGGCAACTCCATCCCCTCCTCCACCACCCGCTGGATGTGAAAAGCTTTCCG
GAGCCCATCTTGGAAGAGCCTAAAAGGCGGCAACACCAACACCTCTTGACATGGAAATAC
ACTGATACAATAGGCAAAAGGAAACACTCGATTGCATCTTCCCGGTTCCAGGTGGCCTTA
TTTGGGAGATTCTATACTGACCTTATTCCTGTGATGGAGGATACTGGCATCCAGCGAGGC
ATCTGGGATGGAGATGCCAAGGCTGTCCAACAATGTCTGACAGATATTTTTACCAGCGTT
TACACCACCTGCGACATCCCTGAGAATGCTATATTTGGTCCCTGTGTCCTGAGCCATACT
TCCCTATATGACAGCATAGCTTTCATAGCTCTCAAGTCTACTGACAAGAGAACAGTACCG
TATATCTTTCGGGTAGACACCTCAGCAGCAAATGGTTCCTCAGAAGGTCTCATGTGGCTG
CGGTTGGTCCAATCGGCCAGAGATAAGGAAGAGCAGAACCTTGAAGCCTACATAAAAAAC
GGACAGCTGTTCTACCGCTCTCTCCGCAGGATTGCCAAAGACGAGGAGTTACTAGTTTGG
TACGGGAAAGAACTGACTGAGTTACTCTTGCTCTGCCCCTCTAGATCCCACAACAAAATG
AATGCAGGGTCGTCCCCTTACACATGCCTGGAATGCAGCCAACGTTTCCAGTTTGAGTTC
CCCTATGTGGCGCATCTGCGTTTCCGCTGCCCCAAGAGACTTCACAGCGCTGATATAAGT
CCCCAAGACGAACAAGGCGGCGGCGTGGGCACCAAGGACCACGGGGGCGGCGGCGGCGGT
GGCAAAGACCAGCAGCAGCAGCAGCAGGAGGCACCTTTAGGCCCGGGTCCCAAGTTTTGC
AAAGCCGGCCCCCTCCACCACTACCCATCCCCCTCCCCGGAAAGCAGCAACCCATCCGCT
GCCGCCGGCGGCAGCAGCGCGAAGCCATCCACAGACTTCCACAACCTGGCCAGGGAGCTG
GAAAACTCCCGGGGAGGCAGCAGCTGCTCCCCAGCCCAGAGCCTCAGCAGCGGTAGCGGC
AGCGGCGGCGGCGGCGGCCACCAGGAGGCGGAGCTGAGTCCCGACGGCATCGCCACGGGC
GGCGGCAAAGGAAAGAGGAAATTCCCGGAGGAGGCGGCGGAGGGCGGCGGTGGCGCTGGT
CTGGTAGGGGGCCGGGGCCGCTTCGTAGAGCGGCCCCTCCCGGCCTCCAAGGAGGATCTG
GTGTGCACACCGCAGCAGTACCGAGCCTCGGGCAGCTACTTCGGCCTGGAAGAGAACGGC
CGCCTCTTCGCGCCGCCAAGTCCCGAGACGGGCGAGGCGAAGCGCAGCGCCTTCGTGGAG
GTGAAGAAGGCTGCCCGCGCGGCCAGCCTGCAGGAGGAGGGGACAGCCGACGGCGCGGGA
GTCGCCTCCGAGGACCAGGACGCTGGCGGCGGCGGCGGCTCCTCCACGCCCGCGGCCGCG
TCACCGGTGGGCGCCGAGAAGCTGCTGGCCCCGCGGCCTGGGGGCCCGCTGCCCAGCCGG
CTCGAGGGCGGCAGTCCTGCGAGGGGCAGCGCCTTCACTTCGGTGCCGCAGCTGGGCAGC
GCGGGCAGCACCAGCGGTGGGGGCGGAACGGGCGCCGGGGCCGCAGGCGGCGCGGGCGGG
GGCCAGGGCGCCGCGTCGGACGAGCGCAAAAGCGCCTTCTCGCAGCCAGCACGCTCTTTC
TCGCAGCTGTCCCCGCTGGTGCTGGGCCAGAAGCTGGGCGCGCTCGAGCCATGCCACCCC
GCCGACGGCGTGGGCCCCACCAGACTCTATCCCGCCGCCGCGGACCCTCTAGCGGTGAAG
CTCCAGGGGGCCGCGGACCTGAACGGAGGTTGCGGGTCCCTGCCGAGCGGCGGCGGCGGC
CTGCCTAAGCAGAGCCCCTTCCTGTACGCCACCGCCTTCTGGCCCAAGAGCTCCGCTGCC
GCTGCAGCCGCGGCTGCGGCGGCGGCCGCGGGGCCCTTGCAGCTGCAGCTGCCCTCGGCG
CTCACGCTGCTGCCGCCCTCCTTCACCTCGCTGTGTCTGCCCGCGCAGAACTGGTGCGCC
AAGTGCAATGCCTCCTTCCGCATGACCTCCGACCTGGTGTACCATATGAGGTCGCACCAC
AAAAAGGAGTATGCGATGGAGCCCTTGGTGAAGCGGCGGCGAGAGGAGAAACTCAAGTGC
CCCATCTGCAATGAGTCCTTCAGGGAGCGCCACCACCTCTCCAGGCACATGACCTCGCAT
AATTGACTCGGAAAGGACCCCAGCTTTCCACGCGCGCGCAAGCACAGTTAAGCCACCTGC
AGGAATAAACACGCGAGAACATCCACCGCTTCCTTGCACCCCGAAACCCTGCACAAAGAC
ACATACATTCACCGCCCCCCCGCCCCCCCAACGCGCACACACACGTCCTCTCCTCCCAGG
AACCTCATTCAAATATTTACCCGGGACACACACCCCCCCCCACACACACACACAGACACA
CTCACACACAAGAGCCAGGATGGTGGAGTTTTGATTGGGTGGGTTGTTTGAGGGGGTTTT
CTTTTGAATGCACGCATTTTCACTTTCCCCAAAACAAAGGTACATTTTTTAAAATGTCAT
ATATTGCAACATATTGATGCATTTGTCATACGTTTCTACTTAAATTATTAAGCACTTACG
ATTTAGATGTAATAATTATATGTAAGGGCAAAATTTATTTTAGATATAAAGTAAAGGAGG
AGGGTGAGATGCTTTCTGCATTTCTTGATGACAGTTTGTGTTCCTACAAAAATAAACAAA
ATGAATAAAAAGGGATCACCATTCAATTTGAGTTTCCAGGGGGAAGTGCATGTATAATGA
AATGATAATGGACTTCAATGAAGAATGTCATCAATTATGTACATATGTATTTTCTTTTAA
TACAAAGTGTAATTTTGTGCCAGTGAAATGGAGTCTGAATAGTTATGTGTTTCTTTTATC
CCTGGAAATATTTATTAAACTTTATAGTTTATCCGAGTATGTTGGATGCTTTGACAATAA
ATGACTATTTTCTTCAAAGCAAA

Protein Sequence

>56978 : length: 970
MASPCARLAAPRRRPAAAGGRSLPPSCCSRDRGHFARRTGSSAGSDWGGRAAAEGPAVAA
LPGKEPHSPQVIKATWGVIYQPLSSPLFQNNTTVSYMCIFARTPKSLAKVEQAKSSPGLL
GLQSPGCQSLNTPLSSREGSQSWERIKLTWSRELNCEKEARDSPATWCCSPVEGVNLQAV
KDLKSLASAAALKGQVSASKWLSAQTRLPRRPRQLHPLLHHPLDVKSFPEPILEEPKRRQ
HQHLLTWKYTDTIGKRKHSIASSRFQVALFGRFYTDLIPVMEDTGIQRGIWDGDAKAVQQ
CLTDIFTSVYTTCDIPENAIFGPCVLSHTSLYDSIAFIALKSTDKRTVPYIFRVDTSAAN
GSSEGLMWLRLVQSARDKEEQNLEAYIKNGQLFYRSLRRIAKDEELLVWYGKELTELLLL
CPSRSHNKMNAGSSPYTCLECSQRFQFEFPYVAHLRFRCPKRLHSADISPQDEQGGGVGT
KDHGGGGGGGKDQQQQQQEAPLGPGPKFCKAGPLHHYPSPSPESSNPSAAAGGSSAKPST
DFHNLARELENSRGGSSCSPAQSLSSGSGSGGGGGHQEAELSPDGIATGGGKGKRKFPEE
AAEGGGGAGLVGGRGRFVERPLPASKEDLVCTPQQYRASGSYFGLEENGRLFAPPSPETG
EAKRSAFVEVKKAARAASLQEEGTADGAGVASEDQDAGGGGGSSTPAAASPVGAEKLLAP
RPGGPLPSRLEGGSPARGSAFTSVPQLGSAGSTSGGGGTGAGAAGGAGGGQGAASDERKS
AFSQPARSFSQLSPLVLGQKLGALEPCHPADGVGPTRLYPAAADPLAVKLQGAADLNGGC
GSLPSGGGGLPKQSPFLYATAFWPKSSAAAAAAAAAAAAGPLQLQLPSALTLLPPSFTSL
CLPAQNWCAKCNASFRMTSDLVYHMRSHHKKEYAMEPLVKRRREEKLKCPICNESFRERH
HLSRHMTSHN