ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

56946

Name

C11orf30

Synonym

EMSY|GL002;chromosome 11 open reading frame 30;C11orf30;chromosome 11 open reading frame 30

Definition

protein EMSY

Position

11q13.5

Gene Type

protein-coding

External Links

Links to cell senescence gene database

56946

Links to epithelial mesenchymal transition gene database

56946

Links to ovarian cancer gene database

56946

Links to endometrial cancer gene database

56946

Links to iHOP

56946

Sequence Information

Nucleotide Sequence

>56946 : length: 6916
GTCGCCATCTTGCCCCTTCAGAGGCACCGCAAACAAACCCAATTCCTGGTGTCCCCTAGT
CTTGGCGGAGGAGCCTTTTAGATGAGCCCCGAAAGGCCGGGCAGGGAGGACAAGCTCTTT
GGGGCTACCAAACAGAAGCAGCAATGCCTGTTGTGTGGCCAACCCTTCTGGATCTCAGCA
GGGATGAATGCAAAAGAATTCTTCGAAAATTGGAATTGGAGGCATATGCTGGAGTTATCA
GTGCACTTCGGGCACAGGGGGATCTCACCAAGGAAAAGAAAGATCTTCTTGGAGAACTAT
CAAAAGTTCTTAGCATCTCAACAGAACGCCACCGTGCTGAAGTTCGGAGAGCAGTAAACG
ATGAACGGTTAACAACAATTGCACATAAAATGAATTTATCCTTATATTTGGGTGAAAGAC
CAAGTTACAGTATGTCTGGACCTAATAGCTCTTCAGAATGGTCCATTGAAGGTCGTCGAT
TGGTACCACTGATGCCCCGGCTCGTTCCCCAAACCGCCTTTACTGTAACAGCTAATGCTG
TTGCTAATGCAGCTATCCAGCATAATGCATCTCTTCCAGTGCCTGCAGAAACAGGAAGCA
AGGAAGTAGTGGTTTGCTATTCCTACACAAGTACCACGTCAACCCCAACCTCTACCCCTG
TTCCAAGTGGCAGCATAGCAACGGTTAAGTCTCCAAGACCTGCCAGTCCTGCCTCCAATG
TAGTTGTCTTGCCAAGTGGAAGTACTGTTTATGTCAAAAGTGTAAGCTGTTCAGATGAAG
ATGAAAAACCCAGAAAACGAAGGCGAACAAACTCTTCCAGCTCCTCTCCTGTTGTTCTAA
AGGAAGTTCCAAAGGCCGTTGTTCCAGTCTCAAAGACGATCACTGTGCCTGTGAGTGGTA
GTCCCAAGATGAGCAACATCATGCAGAGCATTGCCAACTCCTTACCACCCCACATGTCTC
CTGTAAAAATAACCTTCACTAAACCATCAACACAGACAACAAACACAACAACACAGAAGG
TTATTATAGTCACCACATCACCAAGCTCAACCTTCGTGCCCAACATTCTCTCCAAATCCC
ATAACTATGCAGCAGTCACTAAGCTTGTACCAACGTCAGTCATTGCTTCTACAACCCAGA
AGCCACCAGTTGTTATAACTGCTTCACAGTCCTCTCTGGTCAGTAATAGCAGCAGTGGCA
GCAGCAGTTCTACACCATCACCTATTCCTAATACAGTTGCAGTAACAGCTGTGGTGTCCT
CTACACCATCTGTGGTCATGTCAACAGTAGCACAAGGTGTATCTACATCAGCAATCAAAA
TGGCATCAACCAGACTTCCTTCCCCCAAAAGCTTAGTGAGTGCCCCAACTCAGATTCTTG
CACAGTTCCCTAAACAACATCAACAGTCTCCTAAGCAGCAGTTATATCAAGTGCAACAGC
AGACACAGCAACAAGTGGCCCAGCCTTCTCCAGTATCTCATCAGCAACAGCCTCAGCAGT
CTCCTTTGCCACCTGGTATTAAACCTACCATCCAAATCAAACAGGAGTCAGGTGTTAAAA
TCATCACACAACAGGTTCAACCAAGTAAAATCTTACCCAAACCAGTGACAGCAACTCTAC
CCACCAGTAGCAATTCCCCTATTATGGTGGTTAGCAGTAATGGTGCAATTATGACAACTA
AACTGGTAACCACTCCTACTGGCACACAAGCAACCTATACCCGGCCAACAGTGAGCCCAT
CCATTGGTCGGATGGCTGCAACCCCTGGAGCTGCAACCTATGTGAAAACTACGAGTGGTA
GCATCATTACAGTAGTACCCAAATCATTAGCTACCTTGGGGGGCAAGATAATTAGCAGTA
ATATAGTTTCTGGAACGACTACCAAAATCACTACAATCCCAATGACTTCCAAGCCCAACG
TGATTGTTGTACAAAAGACTACAGGAAAAGGAACGACCATTCAAGGCCTCCCGGGCAAAA
ATGTTGTCACAACGTTGCTAAATGCTGGAGGAGAAAAGACTATTCAGACAGTGCCAACAG
GAGCAAAGCCAGCTATCCTTACTGCTACAAGACCCATCACCAAAATGATTGTAACGCAGC
CAAAAGGAATAGGTTCTACAGTTCAACCAGCAGCTAAAATCATCCCAACAAAAATTGTTT
ATGGGCAGCAAGGGAAAACGCAGGTTCTTATTAAACCCAAACCAGTGACTTTTCAAGCGA
CAGTTGTTAGTGAACAAACAAGACAGCTAGTAACAGAAACATTACAGCAAGCATCCAGGG
TAGCAGAGGCTGGTAATTCATCTATTCAGGAAGGAAAAGAAGAACCACAGAATTATACAG
ATAGTAGTTCCTCTTCTACAGAGTCCTCCCAGAGTTCCCAAGATTCCCAGCCTGTAGTTC
ATGTAATTGCTTCCCGGCGTCAGGATTGGTCAGAACATGAGATTGCAATGGAGACTAGCC
CTACCATAATTTATCAGGATGTATCCAGTGAATCACAATCAGCTACTTCAACAATCAAAG
CTCTGTTAGAACTCCAACAGACAACAGTAAAGGAAAAATTGGAATCTAAACCAAGACAAC
CCACTATTGACCTGAGTCAAATGGCAGTGCCTATTCAGATGACCCAGGAAAAGAGACATT
CTCCTGAGAGTCCATCAATTGCTGTGGTAGAGTCAGAACTAGTAGCTGAATACATCACTA
CTGAACGCACTGATGAGGGGACAGAGGTTGCTTTTCCCCTTCTAGTCAGCCATCGCTCCC
AGCCCCAACAGCCTTCCCAGCCCCAGCGGACCCTGCTCCAGCATGTGGCTCAGTCACAGA
CCGCAACACAGACTTCGGTGGTGGTGAAGTCCATCCCAGCATCTTCCCCTGGAGCAATCA
CCCACATTATGCAGCAGGCATTAAGCAGTCACACTGCTTTTACCAAACACAGCGAGGAAC
TTGGAACTGAGGAGGGCGAGGTTGAAGAGATGGACACTTTAGACCCTCAGACAGGTCTGT
TTTACCGATCTGCCCTGACTCAGTCACAGTCAGCTAAACAGCAGAAACTTAGCCAGCCCC
CGCTGGAACAGACTCAGCTGCAAGTGAAAACTCTGCAGTGCTTCCAGACTAAACAGAAGC
AGACCATCCACCTGCAGGCAGACCAGCTCCAGCACAAACTCCCGCAAATGCCCCAGCTTT
CCATCAGGCATCAAAAACTCACCCCTCTCCAGCAAGAACAAGCACAGCCCAAGCCAGATG
TACAGCACACACAGCATCCCATGGTGGCCAAAGACAGGCAGCTTCCTACCTTAATGGCAC
AGCCCCCGCAAACTGTAGTACAGGTGCTTGCAGTGAAAACCACGCAGCAGCTCCCTAAAC
TGCAGCAGGCTCCGAACCAACCAAAAATCTACGTGCAACCCCAAACCCCCCAGAGCCAAA
TGTCGCTCCCAGCTTCTTCAGAGAAACAGACGGCAAGCCAGGTGGAGCAGCCAATTATAA
CCCAAGGATCCTCTGTTACAAAGATAACTTTTGAGGGGCGCCAGCCTCCCACAGTTACAA
AGATAACTGGTGGCAGTTCTGTGCCTAAGCTGACATCACCAGTTACAAGCATATCTCCCA
TTCAGGCCTCTGAGAAGACAGCAGTGTCTGACATTTTGAAAATGTCTTTGATGGAAGCTC
AGATTGATACAAATGTAGAACATATGATAGTGGATCCCCCAAAGAAGGCTCTTGCCACTA
GCATGCTCACTGGTGAAGCAGGATCATTACCCTCCACCCACATGGTGGTGGCAGGGATGG
CGAATTCCACTCCCCAGCAACAGAAATGTAGAGAGTCCTGTTCGAGTCCATCCACTGTTG
GCTCTTCCCTAACGACAAGGAAAATTGATCCACCAGCAGTGCCTGCGACAGGCCAGTTCA
TGCGTATTCAGAATGTAGGCCAAAAGAAAGCTGAAGAGAGTCCAGCAGAAATTATCATCC
AGGCTATTCCTCAGTATGCTATTCCTTGTCACTCCAGCTCCAATGTGGTGGTGGAGCCCA
GTGGGCTTCTTGAGCTAAACAACTTCACTAGTCAACAGCTGGATGATGAGGAGACAGCAA
TGGAGCAGGACATAGACAGTAGCACGGAGGATGGAACTGAACCCAGCCCTTCTCAGAGCT
CTGCTGAACGGTCCTAGTGTTTGGACACAATAGTGCACTTTAAAACCTGCTTGGTTACCA
AGTGTCCAGGGAAACCCTTGTATTTTGATGACTAAAAAGAGCACTTTGCCCGTACTTAGG
CTGTGGACCCTAAAACAGCAGTGTTTCAACAAGATGTTGCTGCAGGAGCAGCTTTTTAAA
ACAAGATAAAACTCACAGGGGAATGTACTTTTTTAAAAAAAAATGAAAAAGAAAAAAAAA
GCTGCACATTTACAGTGACTTAAGACCTGGTCTTCTTTCTCTGTTGGATCATGGCCGGTG
AAACAGTTTTGTCTTGCAGTGGAAAGAGACTTCCTGTGAATGTTTCTCAACTGGTTTCTA
CTGAGCAAAATACCATCTAAAAGGAGAATGTGAATAGTTGTATTTTGAAATGATGTGTCA
GGAAAAGTTTTTTAAAAACTTGTATGTTTTTGCAAATCCCTGGAAGTGTTGAATTGGTTA
AAATTTTACATTTTCTCAGTTCATAATTAGTTTATAAACACCTAGAATAATACTGGCATT
AAAGAATCCTTGTTGGATGGTAGAAATCAGATCCCTAACCAGTGGGAGGTACTTTTTGGG
TGGCTTGTGCATTCTTATCAGTTGTGTGCTAATTTATTGTATTGTTCCTTTGTGCTCTAA
GCAGCACACTTGCCTTCTATTTATTTAAGTGTAAACATTTCAAAGCAGGCCGTACTCCTT
CTGACAAATTTCTTGTAAACCAGGATTGCCTACGCTTTCCACTGTCGTCGTCTCCCCACT
TTCCCTCTTCCTTTAAGAAAACTTACTAAAAAATGTTTCATTGCGAAGCAGAGGAAAAGA
AACGTTTTCAGACCTAAAGGAAATGTTTGGTCATGTTAAGAAAACAAATTATTCATTCAT
ATGATGCTTTCTTAACGTTGAAATTGCACATTCACATTGGACTGAGACTTTGAAAATAAC
TTTTACATACTTTTGTTTAAGCCCCTTTGAAATGTATAAAAAGTTCATTTACAGTTCTAA
ATGTAATGTTTTTAAGCCTTCTATCTTTTTAGGACACAGTTTGTTTAAGCAATATGTTTT
GGTCTTGTGATCACTGTCTGTCACAAGTAGAGTGAAAGGGGTAAGGGGGTGGGAGGGTAA
GAGTTTTGACAAGTTGTGGCAAAGGAAACTATACTTTTCATTTTTAAAAATGTAAATAGA
AAAGTTTTTAACGGTTTTATATAGATTTCACTATAAATAAGCATTTTAAGACTGACAAAT
GTTGAACTGTACATACATTTATCAGCATAACTGCCCAGTTTTTTTGGTGCTGAAGTACTG
TAAGTAGAATTCATCAACGGTCTCCTAATTTTTGCATCTACATCTGGGGGGAAAAAGCTG
TGATACTATAGTTAATAAATTCCCACTAGAGTGACACTGAAGATTTAAACACAAGCATTC
ATAAGATGCGCTGATCTCTGGTGGTTGTCACTAGTTCTGCTAGGTGATAATGATTTACCC
ATAGATGGAGCTGTTGGATATTATTTTATTGTACAAATTCATGTTTAAAAAACTTTGTGA
CTGTTTCTAGTTAAGTAATTTTTTAACCTTTCTTGGGTCATAGACTTCTTTGGTAAACTA
TGAACTCTCACCAAAAAGATACACATGCAACATGTTAAATACATGTTAGACTTTGCATAC
AATTTTAGGGGCTCATGGGCCTCTAAGCCTATCCATGTATTCCAGGTTAAGCCCTCTGTT
ATGATCAATCCATTACTTACAGATTAAGTTTTTATAAAATAAAGTATCTTTTAAATATTC
ATGGATCAAGTAACAAGAGCAAACTTGAATAAAGTTATGTTCTACATATTTTGGCAGCAT
AGCATACCTGTGTCCCTTGAGAATTTAGCCTTCATATGTTTCTGCAATTGGAATGGCAAA
TAAAAGTGCTATCATCTACATTTTTTTAAAGAATTACAAATATTAAGAAATTATCAAGTG
AAATTTAAAATTTTTCTTTTAAAGGTGTTAATTCCAAATAGAGCATGCATTCATTTATTT
ATTCAACAAATATTAATTGAGCATCTTCTGTATGACAAGTAGTATTCTGTGCACTGGGGA
TACCATAGTGAACAAACAGGAAATCCTATCCTTATGAAGTTTATAAACAGGGCTTCCTGC
TCATGAAATGGATACAAGGAATGAAGACAGGAGAAAATAAGAACAATACTTAGGTTTTTT
TATAAAGTGGATAGATGATGATGCCATATATGGATTTTCAGACATCCCTTTACTGAAAGT
CTTAGCATTATATCTATTAGTATTCCACATTTAAGTACATAATTTAAAAGTAATTTAAAG
TCATCTCTTTGAAGGATATTAACAAATTACAATGCAAATGCTACAGAATTTTTAGAATCC
TAACAACTATTAGGCAGTGATAAGAAAAATCCATTTGGCTTAAAGTAAACTTTAATAAGT
GCCTAGTATTGCAGATGCAGTTTATGGTGAACTTAGAGGATTAAAAACCAAAGGGGGCTT
CATTGAGATATTCACATGCCATAAACTCTCCCATTTAAAGTATACCGTTTAATGGTTTTA
GTATATCCACAGAGTTGGGCAAGCCATTACCACAATCAATTTGAGAACATTTTCATTAAT
CACAAAAGAAATCCTGAAATGAAACCACCACCACCATCGCTCCAGCCCTGGGTGGCCACT
CCTCTACTTTCTGCCTCTTATGGATGTGCCATAAGAAATGTGGACATTTCATATAAATGA
GATTATATAAAAAAAA

Protein Sequence

>56946 : length: 1353
MPVVWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSIST
ERHRAEVRRAVNDERLTTIAHKMNLSLYLGERPSYSMSGPNSSSEWSIEGRRLVPLMPRL
VPQTAFTVTANAVANAAIQHNASLPVPAETGSKEVVVCYSYTSTTSTPTSTPVPSGSIAT
VKSPRPASPASNVVVLPSGSTVYVKSVSCSDEDEKPRKRRRTNSSSSSPVVLKEVPKAVV
PVSKTITVPVSGSPKMSNIMQSIANSLPPHMSPVKITFTKPSTQTTNTTTQKVIIVTTSP
SSTFVPNILSKSHNYAAVTKLVPTSVIASTTQKPPVVITASQSSLVSNSSSGSSSSTPSP
IPNTVAVTAVVSSTPSVVMSTVAQGVSTSAIKMASTRLPSPKSLVSAPTQILAQFPKQHQ
QSPKQQLYQVQQQTQQQVAQPSPVSHQQQPQQSPLPPGIKPTIQIKQESGVKIITQQVQP
SKILPKPVTATLPTSSNSPIMVVSSNGAIMTTKLVTTPTGTQATYTRPTVSPSIGRMAAT
PGAATYVKTTSGSIITVVPKSLATLGGKIISSNIVSGTTTKITTIPMTSKPNVIVVQKTT
GKGTTIQGLPGKNVVTTLLNAGGEKTIQTVPTGAKPAILTATRPITKMIVTQPKGIGSTV
QPAAKIIPTKIVYGQQGKTQVLIKPKPVTFQATVVSEQTRQLVTETLQQASRVAEAGNSS
IQEGKEEPQNYTDSSSSSTESSQSSQDSQPVVHVIASRRQDWSEHEIAMETSPTIIYQDV
SSESQSATSTIKALLELQQTTVKEKLESKPRQPTIDLSQMAVPIQMTQEKRHSPESPSIA
VVESELVAEYITTERTDEGTEVAFPLLDAVVISGEISSPPLFSVSHRSQPQQPSQPQRTL
LQHVAQSQTATQTSVVVKSIPASSPGAITHIMQQALSSHTAFTKHSEELGTEEGEVEEMD
TLDPQTGLFYRSALTQSQSAKQQKLSQPPLEQTQLQVKTLQCFQTKQKQTIHLQADQLQH
KLPQMPQLSIRHQKLTPLQQEQAQPKPDVQHTQHPMVAKDRQLPTLMAQPPQTVVQVLAV
KTTQQLPKLQQAPNQPKIYVQPQTPQSQMSLPASSEKQTASQVEQPIITQGSSVTKITFE
GRQPPTVTKITGGSSVPKLTSPVTSISPIQASEKTAVSDILKMSLMEAQIDTNVEHMIVD
PPKKALATSMLTGEAGSLPSTHMVVAGMANSTPQQQKCRESCSSPSTVGSSLTTRKIDPP
AVPATGQFMRIQNVGQKKAEESPAEIIIQAIPQYAIPCHSSSNVVVEPSGLLELNNFTSQ
QLDDEETAMEQDIDSSTEDGTEPSPSQSSAERS