ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

55971

Name

BAIAP2L1

Synonym

IRTKS;BAI1-associated protein 2-like 1;BAIAP2L1;BAI1-associated protein 2-like 1

Definition

BAI1-associated protein 2-like protein 1|brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1|insulin receptor tyrosine kinase substrate

Position

7q22.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

55971

Links to epithelial mesenchymal transition gene database

55971

Links to ovarian cancer gene database

55971

Links to endometrial cancer gene database

55971

Links to iHOP

55971

Sequence Information

Nucleotide Sequence

>55971 : length: 3682
GGGGCCGCCCGGCCCGCCCAGCTTCCTCTGGCGGCGTCCGGCCGCTTCTCCTCTGCTCCT
CGAAGAAGGCCAGGGCGGCGCTGCCGCAAGTTTTGACATTTTCGCAGCGGAGACGCGCGC
GGGCACTCTCGGGCCGACGGCTGCGGCGGCGGCCGACCCTCCAGAGCCCCTTAGTCGCGC
CCCGGCCCTCCCGCTGCCCGGAGTCCGGCGGCCACGAGGCCCAGCCGCGTCCTCCCGCGC
TTGCTCGCCCGGCGGCCGCAGCCATGTCCCGGGGGCCCGAGGAGGTGAACCGGCTCACGG
AGAGCACCTACCGGAATGTTATGGAACAGTTCAATCCTGGGCTGCGAAATTTAATAAACC
TGGGGAAAAATTATGAGAAAGCTGTAAACGCTATGATCCTGGCAGGAAAAGCCTACTACG
ATGGAGTGGCCAAGATCGGTGAGATTGCCACTGGGTCCCCCGTGTCAACTGAACTGGGAC
ATGTCCTCATAGAGATTTCAAGTACCCACAAGAAACTCAACGAGAGTCTTGATGAAAATT
TTAAAAAATTCCACAAAGAGATTATCCATGAGCTGGAGAAGAAGATAGAACTTGACGTGA
AATATATGAACGCAACTCTAAAAAGATACCAAACAGAACACAAGAATAAATTAGAGTCTT
TGGAGAAATCCCAAGCTGAGTTGAAGAAGATCAGAAGGAAAAGCCAAGGAAGCCGAAACG
CACTCAAATATGAACACAAAGAAATTGAGTATGTGGAGACCGTTACTTCTCGTCAGAGTG
AAATCCAGAAATTCATTGCAGATGGTTGCAAAGAGGCTCTGCTTGAAGAGAAGAGGCGCT
TCTGCTTTCTGGTTGATAAGCACTGTGGCTTTGCAAACCACATACATTATTATCACTTAC
AGTCTGCAGAACTACTGAATTCCAAGCTGCCTCGGTGGCAGGAGACCTGTGTTGATGCCA
TCAAAGTGCCAGAGAAAATCATGAATATGATCGAAGAAATAAAGACCCCAGCCTCTACCC
CCGTGTCTGGAACTCCTCAGGCTTCACCCATGATCGAGAGAAGCAATGTGGTTAGGAAAG
ATTACGACACCCTTTCTAAATGCTCACCAAAGATGCCCCCCGCTCCTTCAGGCAGAGCAT
ATACCAGTCCCTTGATCGATATGTTTAATAACCCAGCCACGGCTGCCCCGAATTCACAAA
GGGTAAATAATTCAACAGGTACTTCCGAAGATCCCAGTTTACAGCGATCAGTTTCGGTTG
CAACGGGACTGAACATGATGAAGAAGCAGAAAGTGAAGACCATCTTCCCGCACACTGCGG
GCTCCAACAAGACCTTACTCAGCTTTGCACAGGGAGATGTCATCACGCTGCTCATCCCCG
AGGAGAAGGATGGCTGGCTCTATGGAGAACACGACGTGTCCAAGGCGAGGGGTTGGTTCC
CGTCGTCGTACACGAAGTTGCTGGAAGAAAATGAGACAGAAGCAGTGACCGTGCCCACGC
CAAGCCCCACACCAGTGAGAAGCATCAGCACCGTGAACTTGTCTGAGAATAGCAGTGTTG
TCATCCCCCCACCCGACTACTTGGAATGCTTGTCCATGGGGGCAGCTGCCGACAGGAGAG
CAGATTCGGCCAGGACGACATCCACCTTTAAGGCCCCAGCGTCCAAGCCCGAGACCGCGG
CTCCTAACGATGCCAACGGGACTGCAAAGCCGCCTTTTCTCAGCGGAGAAAACCCCTTTG
CCACTGTGAAACTCCGCCCGACTGTGACGAATGATCGCTCGGCACCCATCATTCGATGAG
AGGACAGCCAAGGACTCTCCCGGGCCTCTCCGGTTCTCCCTTGCGGAATGATGGGCGCAT
CCTGTCTGCCACGTGCTGACGGTCGGGAAGCTTCAGTGGAGAGGCCTAACTCTAATGTCG
CCTGCTTAAGCAAATCATGCTTCTCTGTTTCACGTAGTTGGGTTGACAAGTTTCTGCCTT
TAAGATAAATGAGTAATAGTCTAATGACCAGCTCAGCCATTTAAAATATTTTCTTCCTAT
TCTGTTCAAGAAACAGTAAACTTGGTTTCAATCTTTACTGTATTTTTTAAATGAATTTTT
TCCTTAATAACAGCCAGAATAAGGGATAGTCTATGCTTTCAGGACTGGCTTTCTGCACCT
GATATGAATGAGACCAGTTTTATTTTATAAAGCATGTGCTCTTAATAGCATTATGTCTAA
AGAAGATATCACGTAAGTTTGCATCTTAGCATGCAAATCATAATTTTAAGCAATATAAAT
TATGAAAATACTATATAAATGTAATTTAACTTAAAATGTTTAAGTGTAGAGCTTCCAGAG
ATGGAGAAACCCCCACCCTCCCTCCAACCACGCCAGAGCTGTAGAGTGCTAAGACGCTTT
GCCTGCCCTTATCACAGCCACACGTAGCACTCGACGAAATCTCCTCCGAGAGCTCCTTTT
CTTGGTAGTTAGGAGTCGCCAACGGATTCGCTGCACACGGCCCATCCAGGACACAGGCCT
GGGCGTCGGAGTCACGGCTCCTTGTGTTCTCACTCAGCTAGTTGGCCAAAGCTGCATCCA
TTACCAGTACACTCAAACTGCTCGGGGTCCTGGTTTCTCCGTGTTTGAATCAGGTACAGA
CTCTCAAAGGATACGTGTAAAGCCAGGATGACCTCTGGTGCCTGGAGAAGGGCGGGTTTT
TCAGCCTAGCAGCCATGATGCCCTCGGAACCTGGCCCTATGGTATGGATGTGAGGACTAC
GCACTGGCTGCCCTGAGCCCGGGGCTGGAAATCATCTTTGGCTGCCAAGGATCTGGACCT
ATTTTGGAGTGGAGAGTCATGGTTAAAATTCCCAGCCCGGCCCAGGTACGGGAATCCCAG
CATTTTGTGAGGCCGAGGCAGGGGGATCACCTGAGGTCAGGAGTCTCTACTAAAAATACA
AAAATTAGACAGGTGTGGTGGTGGGCGCCACTCAGGAGGCTGAGGCAGGAGAATCACTTG
AACCCGGGAGGCAGAGGTTGCAGTGAGCCAGATCATGCTGCTGCACTCCAGCCCGGCCGC
TCACCGTGTGTGTTGCTGGGTGCTGGGGCTGTGACTTATCCCCTCTCCTTTAGCCTTGCC
ATAAGTGTAGTATCCTATGAGGCTGAGATTGGGAAAGGTTACATGCAGGTAAGCCAGTGG
ACGTGGCCGATGCTTCAGGCTCCTTCCAGCCAGGTCCAGCAGTGTTACCATCTGCTTCTC
CTGGGAGGACAAACCAGGCACCCCCACCATGAAGGGGCTGCAGGCACCATGAACTATGTT
AACAACCCCAGTCTGTACTACAGAAAGGGCTGCAGCCACATGAGAATTCAGTCCACACAA
GCCCCATGGCCGTGTTCCCCACTTCAGCCACAGGGCTCAGGGAGCCCCATCTGGCGCTAA
GGGGAACTGCTGGGGTGTGGGTGACACCTGGCCTTTGGCGTTCTGCCTTGGGGAGGTTTC
TGGTTTTGTTACGGGGTGGAAGAATAGGACCTGGGGGTCTCGGATGCAACCTGCAGACCC
CGTGGCTCACCCAACCCCAGGTTCTGCCTCCCAGACCAGAACGGGCATGGCCTGGTCCTT
GGCACCGAGGTGCCTGCTCTGTAAATATCAAGGGATTACAACTTTAATAATAAAGCAGAA
CTTGAAAACAAAAAAAAAAAAA

Protein Sequence

>55971 : length: 511
MSRGPEEVNRLTESTYRNVMEQFNPGLRNLINLGKNYEKAVNAMILAGKAYYDGVAKIGE
IATGSPVSTELGHVLIEISSTHKKLNESLDENFKKFHKEIIHELEKKIELDVKYMNATLK
RYQTEHKNKLESLEKSQAELKKIRRKSQGSRNALKYEHKEIEYVETVTSRQSEIQKFIAD
GCKEALLEEKRRFCFLVDKHCGFANHIHYYHLQSAELLNSKLPRWQETCVDAIKVPEKIM
NMIEEIKTPASTPVSGTPQASPMIERSNVVRKDYDTLSKCSPKMPPAPSGRAYTSPLIDM
FNNPATAAPNSQRVNNSTGTSEDPSLQRSVSVATGLNMMKKQKVKTIFPHTAGSNKTLLS
FAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEENETEAVTVPTPSPTPVRS
ISTVNLSENSSVVIPPPDYLECLSMGAAADRRADSARTTSTFKAPASKPETAAPNDANGT
AKPPFLSGENPFATVKLRPTVTNDRSAPIIR