ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

55885

Name

LMO3

Synonym

RBTN3|RBTNL2|RHOM3|Rhom-3;LIM domain only 3 (rhombotin-like 2);LMO3;LIM domain only 3 (rhombotin-like 2)

Definition

LIM domain only protein 3|neuronal-specific transcription factor DAT1|rhombotin-3

Position

12p12.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

55885

Links to epithelial mesenchymal transition gene database

55885

Links to ovarian cancer gene database

55885

Links to endometrial cancer gene database

55885

Links to iHOP

55885

Sequence Information

Nucleotide Sequence

>55885 : length: 3850
CACACGAGAGCGAGCGAGGGAGCCAGCGAGAGAGGGAGGGAGAGAAGGAAAGAAGAGGGG
AGGGGTGGGGGCGAGAGGTAAATAGTCTTAAATCGGAAGGGAGCTGCTTCTCTGTGGTCT
TGACAAGCGCTGCCTGGGCTCCGCCGGCTCACTAATAACTGAGTGACCTTTTCTTTGGCT
GTATTATGTCTGGCTGGGAAGGGATTGCATTTTGCAGCTGAGAGCCGGAGCTTCCTTCAG
CTCGGCTCCTCGCACGCTGCTGGGGTAAGTTGTCTTGAACCAGGACGGAGAGAGACAGCC
TCGGACTGCAGTTGCCTAAAAGGAGGACACCTGTGGCTCAGATGCGGTCAACACCATTGC
TTGGCGTATCCTTGAGGACCTCATTATTTTAAACTTAAAAAAAAATAGACATTCCCTCCC
CCGTCTTTTTTTTTTTTTTCAAACAATGCTTCTTTTTGACCTTTCCCAAGGAGAAGCGCT
ACAAAGCAGCCACTGTGCTTACTGAACGGCCTCCCCCTGTATCGCTTAATTGAGAAGGTA
TACAAATGCTCTCAGTCCAGCCAGACACCAAGCCGAAAGGTTGTGCTGGCTGCAACCGAA
AGATCAAGGACCGGTATCTTCTAAAGGCACTGGACAAATACTGGCATGAAGACTGCCTGA
AGTGTGCCTGCTGTGACTGTCGCTTGGGAGAGGTGGGCTCCACCCTGTACACTAAAGCTA
ATCTTATCCTTTGTCGCAGAGACTATCTGAGGCTCTTTGGTGTAACGGGAAACTGCGCTG
CCTGTAGTAAGCTCATCCCTGCCTTTGAGATGGTGATGCGTGCCAAGGACAATGTTTACC
ACCTGGACTGCTTTGCATGTCAGCTTTGTAATCAGAGATTTTGTGTTGGAGACAAATTTT
TCCTAAAGAATAACATGATCCTTTGCCAGACGGACTACGAGGAAGGTTTAATGAAAGAAG
GTTATGCACCCCAGGTTCGCTGATCTATCAACATCACCCCATTAAGAATACAAAGCACTA
CATTCTTTTATCTTTTTTGCTCCACATGTACATAAGAATTGACACAGGAACCTACTGAAT
AGCGTAGATATAGGAAGGCAGGATGGTTATATGGAATAAAAGGCGGACTGCATCTGTATG
TAGTGAAATTGCCCCAGTTCAGAGTTGAATGTTTATTATTAAAGAAAAAAGTAATGTACA
TATGGCTGGATTTTTTTGCTTGCTATTCGTTTTTGTGTCACTTGGCATGAGATGTTTATT
TTGGACTATTGTATATAATGTATTGTAATATTTGAAGCACAAATGTAATACAGTTTTATT
GTGTTACCATTTGTGTTCCATTTGCTTCTTTGTATTGTTGCATTTAGTACAATCAGTGTT
TAAACTTACTGTATATTTATGCTTTCTGTATTTACCAGCTATTTTAAATGAGCTGTAACT
TTCTAGTAAAGAATTGAAAAGCAAATCTCACTAATGATACACAGATAGATAAAGCAAGTC
TATCAACATTAAAAATACTAAAAAATAAAGACACACACAGAGCATTTTAGTGACATCCAC
TACTTATTGCCGCTATGAGTTAGAGTCTATCAGTGTTCTTGTTATAACCCCCTATTTTCA
GGGGGTTAAAAATCAGCTTTAAAAAAATACATAAAAATTTCATCTTAAAGCACTTTCATT
TTATACCAACGTGAAAAGTGCCATTTTTAGAATAACTTTAAAGCTTAACAGGTTTCCTTT
TAATATCCTTTTTTTGTGTGCTCTTTACTTACACAATGGCTTTGTTTTGCTTTTTCAGCC
ACACCCCTTATGTGAACTAGTGCCTTTGGGTATCACGTAAAATTTTTTCCAAAGGGTTAC
TTTAAAAATCTGTTACCACAATTATGAGATGATTTTTAAGTGATAAATTAAACTTCTTCT
TGTATAAATTCTGCCCAGATCTCTCCACAAGAGCTGAGGGTTTCATAACTTTATGGCTTA
ATAAATGTATGACACTGAAAAGATTTGAGTGTGAATCTACTGAAATCACTATAATGCACA
TTGAAGCTATGATGGTATTTGAGTAGTGAGGTTACTTTTGATCGGAGCAACATAATGCTC
ATAGAATCTTCTAGAAGAAGAGAAACAAAGGGATTGATAAAATGCTGAGAACTAGTGATT
ATATATTTTTCTGTATTTACCTGACATTTATTTTAATGTTCAAAAAGTAAACACTTTAAG
TTTGATGTGTTTTACTCTCTCATTGTTTTAAGTAATTGCCAACTCAGAATACATCATTCT
TAGGCTGAAATTTGTCTTTCCATTTTTTAAGGTGAAATAGTACTACCTTACGTGATAGCA
TACAAAGAAGAAAGCTCTAGAAAGAGAAATTATGGAGAATGATTATTTAAATTACAATTA
AGGAAATGAGAATATGATCCCCTCTTCCGAGTTGCCCACAAACTTGCTTCTTTGCTTTTG
CTCCCTGTAATAGAACTACTTTTCAACAAATCTAATTTTGCACGGCACCGTTAACCATAT
TTTCACTACAGCAAACTTAGTGCTATGGGTTTTCTTTTTCTTTGTTTTTTTCTTGATCAC
TTGTATAGGAAACAATATTTTCCAGTGTTATTTGCATATATATTTTGTCCTTCCAATATA
TGCATTACAGATGAAAATTAAATGTTATACCTGAATTCTTGGGTTGGGGCCAAAATATTA
AGCTGAAAATAATGCTGGTGTGGATTTGTTTTAAAACAAAGCTTTATTATGAACATGCAT
GTGAATCTGGATATTGCCTCTTATTTTTAAGAAAATGGTTCTGTGAAAAGTGAATGATAT
GTATTTTTCCAAATGCTTCATGGTTAGGAGTCTTCAAGTTCCATGTTCCCCAGATTTGAG
ATATACTAAAGAAAGAAATTCAAAAGTAGCTATTTGGGGCCCACAAAAATAACTATTATT
TTAGCCTTAGAGCCTTACACTTGTTTCATGAAGAGAAAGGACTTGCATAACCAAAATAAA
CAAAGCAAGACAAATTAAAAATATGTGGGGGAGAGATCAGTGAAAAGTGGTTTTCTTAAT
GCAGCCCTGCTGGTCCCCATTAACAATTGCTTGAAATTCACATGGATGTAAAATTATAAT
TGTCAGGATCTTATTCAGATGATCTTTTAAGGTTTAACTGGTTTTGCTTTTGTTTATCTA
TATGTCAAAATACTTGTAAATTGGGAACAAACTTCTCTCAGCTTCTTGAAGTTGTTCAAC
TATCCTTGCCACTGGAAGACCAAACAAGGTTTTCACTGCTTTTTCTTTTACATAATATGC
TGAGAATTATTTCTTATGCTTTTTACTACAAACAAAATTACTCACCTGGATTAAAGATTA
AGGCCTTAATCTGTTTAGATTATCTTTAATCTCCATGAAATCGTGAAATAAGACAAGAAT
AGTGTTTCAGCTGTAGGCCATTTTACAGCTAATTGCCCATAAATTGTAGCATTTATTGAC
CTGAAGTACTAAGCTAATTGTCTTGACTACTCAAAGCCCCTGAATTGTTGTCAACTTTCC
CCTTTGTGTTGTGTAGCCCTAACGTCATTTAGCTTGTTGTCTGATGCCTCCAGTAGGACA
CCTCCGATGGAGCTTTGATTTCTGAGCAGCGAAAGCTCCCTTCCTAAGATGCATCTCGCA
TAGGCTGCCTATGATGAAGGACCGTGCACCTCCACTCCAACAGAGTGCTGAGTTTAAAAG
TTGACCTGTGTTTGTAATTTCACTTTCATCTTGCTTAATAAATATCTGCTGGATTCTTTC
ATTCACTTTTTTACATTTGGATTTATGTTTTTAATAAAAGGGGTGTTACACTAAAAAAAA
AAAAAAAAAA

Protein Sequence

>55885 : length: 167
MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEHLKRCGSIYIH
AAHTEIGICVTLEWPLPFVIIDFSQQITIAWLFGVTGNCAACSKLIPAFEMVMRAKDNVY
HLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQVR