ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

55872

Name

PBK

Synonym

CT84|HEL164|Nori-3|SPK|TOPK;PDZ binding kinase;PBK;PDZ binding kinase

Definition

MAPKK-like protein kinase|T-LAK cell-originated protein kinase|cancer/testis antigen 84|epididymis luminal protein 164|lymphokine-activated killer T-cell-originated protein kinase|serine/threonine protein kinase|spermatogenesis-related protein kinase

Position

8p21.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

55872

Links to epithelial mesenchymal transition gene database

55872

Links to ovarian cancer gene database

55872

Links to endometrial cancer gene database

55872

Links to iHOP

55872

Sequence Information

Nucleotide Sequence

>55872 : length: 2127
ATAATCACGACACATTCAACACAGATGTGAGCGTTTGGAGAGAGCTTCAGCCTTCAGCAC
AGGCAACTGTGTTCTATTCACCGGGCTGTGCTCCTCGGAAGGGCTGGTGGTTCCTGTAAA
AGTTTGTGCTCCCCGCGCCTTTCCTTCCTTCCCTCGTCTTTGGCGCCTGCGGGCACCGGG
AGTCCTGGGAGAGGGAGGAGGAACGGCGAATCGGCGGGGCGTGTCCTTCACGCCGCCCCG
TAGCTCGGGGCCGAAGCTGGCGCAGCGCGCGACTTTTTGAAAGCCAGGAGGGTTCGAATT
GCAACGGCAGCTGCCGGGCGTATGTGTTGGTGCTAGAGGCAGCTGCAGGGTCTCGCTGGG
GGCCGCTCGGGACCAATTTTGAAGAGGTACTTGGCCACGACTTATTTTCACCTCCGACCT
TTCCTTCCAGGCGGTGAGACTCTGGACTGAGAGTGGCTTTCACAATGGAAGGGATCAGTA
ATTTCAAGACACCAAGCAAATTATCAGAAAAAAAGAAATCTGTATTATGTTCAACTCCAA
CTATAAATATCCCGGCCTCTCCGTTTATGCAGAAGCTTGGCTTTGGTACTGGGGTAAATG
TGTACCTAATGAAAAGATCTCCAAGAGGTTTGTCTCATTCTCCTTGGGCTGTAAAAAAGA
TTAATCCTATATGTAATGATCATTATCGAAGTGTGTATCAAAAGAGACTAATGGATGAAG
CTAAGATTTTGAAAAGCCTTCATCATCCAAACATTGTTGGTTATCGTGCTTTTACTGAAG
CCAATGATGGCAGTCTGTGTCTTGCTATGGAATATGGAGGTGAAAAGTCTCTAAATGACT
TAATAGAAGAACGATATAAAGCCAGCCAAGATCCTTTTCCAGCAGCCATAATTTTAAAAG
TTGCTTTGAATATGGCAAGAGGGTTAAAGTATCTGCACCAAGAAAAGAAACTGCTTCATG
GAGACATAAAGTCTTCAAATGTTGTAATTAAAGGCGATTTTGAAACAATTAAAATCTGTG
ATGTAGGAGTCTCTCTACCACTGGATGAAAATATGACTGTGACTGACCCTGAGGCTTGTT
ACATTGGCACAGAGCCATGGAAACCCAAAGAAGCTGTGGAGGAGAATGGTGTTATTACTG
ACAAGGCAGACATATTTGCCTTTGGCCTTACTTTGTGGGAAATGATGACTTTATCGATTC
CACACATTAATCTTTCAAATGATGATGATGATGAAGATAAAACTTTTGATGAAAGTGATT
TTGATGATGAAGCATACTATGCAGCGTTGGGAACTAGGCCACCTATTAATATGGAAGAAC
TGGATGAATCATACCAGAAAGTAATTGAACTCTTCTCTGTATGCACTAATGAAGACCCTA
AAGATCGTCCTTCTGCTGCACACATTGTTGAAGCTCTGGAAACAGATGTCTAGTGATCAT
CTCAGCTGAAGTGTGGCTTGCGTAAATAACTGTTTATTCCAAAATATTTACATAGTTACT
ATCAGTAGTTATTAGACTCTAAAATTGGCATATTTGAGGACCATAGTTTCTTGTTAACAT
ATGGATAACTATTTCTAATATGAAATATGCTTATATTGGCTATAAGCACTTGGAATTGTA
CTGGGTTTTCTGTAAAGTTTTAGAAACTAGCTACATAAGTACTTTGATACTGCTCATGCT
GACTTAAAACACTAGCAGTAAAACGCTGTAAACTGTAACATTAAATTGAATGACCATTAC
TTTTATTAATGATCTTTCTTAAATATTCTATATTTTAATGGATCTACTGACATTAGCACT
TTGTACAGTACAAAATAAAGTCTACATTTGTTTAAAACACTGAACCTTTTGCTGATGTGT
TTATCAAATGATAACTGGAAGCTGAGGAGAATATGCCTCAAAAAGAGTAGCTCCTTGGAT
ACTTCAGACTCTGGTTACAGATTGTCTTGATCTCTTGGATCTCCTCAGATCTTTGGTTTT
TGCTTTAATTTATTAAATGTATTTTCCATACTGAGTTTAAAATTTATTAATTTGTACCTT
AAGCATTTCCCAGCTGTGTAAAAACAATAAAACTCAAATAGGATGATAAAGAATAAAGGA
CACTTTGGGTACCAGAAAAAAAAAAAA

Protein Sequence

>55872 : length: 333
MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSP
WAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGE
KSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFE
TIKICDVGVSLPLDENMTAPAFITILLVSVTDPEACYIGTEPWKPKEAVEENGVITDKAD
IFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDES
YQKVIELFSVCTNEDPKDRPSAAHIVEALETDV