ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5581

Name

PRKCE

Synonym

PKCE|nPKC-epsilon;protein kinase C, epsilon;PRKCE;protein kinase C, epsilon

Definition

protein kinase C epsilon type

Position

2p21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Vascular smooth muscle contraction;KEGG PATHWAY;hsa04270

Pathway

Fc gamma R-mediated phagocytosis;KEGG PATHWAY;hsa04666

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway;PANTHER;P00027

Pathway

5HT2 type receptor mediated signaling pathway;PANTHER;P04374

Pathway

Muscarinic acetylcholine receptor 1 and 3 signaling pathway;PANTHER;P00042

Pathway

Thyrotropin-releasing hormone receptor signaling pathway;PANTHER;P04394

Pathway

LPA4-mediated signaling events;PID Curated;200036

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

Endothelin signaling pathway;PANTHER;P00019

Pathway

cardiac protection against ros;PID BioCarta;100163

Pathway

Alpha adrenergic receptor signaling pathway;PANTHER;P00002

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

Endothelins;PID Curated;200004

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

CDC42 signaling events;PID Curated;200057

Pathway

TCR signaling in naive CD4+ T cells;PID Curated;200022

Pathway

protein kinase a at the centrosome;PID BioCarta;100246

Pathway

Histamine H1 receptor mediated signaling pathway;PANTHER;P04385

Pathway

VEGF signaling pathway;PANTHER;P00056

Pathway

phosphoinositides and their downstream targets;PID BioCarta;100059

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Downstream signaling in naive CD8+ T cells;PID Curated;200184

Pathway

Thromboxane A2 receptor signaling;PID Curated;200069

Pathway

Angiogenesis;PANTHER;P00005

Pathway

Alzheimer disease-amyloid secretase pathway;PANTHER;P00003

Pathway

Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664

Pathway

Oxytocin receptor mediated signaling pathway;PANTHER;P04391

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Role of Calcineurin-dependent NFAT signaling in lymphocytes;PID Curated;200076

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

TCR signaling in naive CD8+ T cells;PID Curated;200062

Pathway

Type II diabetes mellitus;KEGG PATHWAY;hsa04930

Disease

Hematocrit;NHGRI

Disease

HEMATOLOGICAL;GAD

Disease

Hematological and biochemical traits;NHGRI

Disease

Hemoglobin;NHGRI

Disease

hemoglobin;GAD

Disease

hematocrit;GAD

External Links

Links to cell senescence gene database

5581

Links to epithelial mesenchymal transition gene database

5581

Links to ovarian cancer gene database

5581

Links to endometrial cancer gene database

5581

Links to iHOP

5581

Sequence Information

Nucleotide Sequence

>5581 : length: 7254
GGTGCTGGCCTGCGCCCCCGAGCCGGATCGGCGGCCGCCCGGACTCCGAGCCCGCGCGGA
TGTGAGATTCCGGGCTCCTGGCGCCTCCCGATCGCCGGCTCCGGCGCGGCGCTGCTTCGC
CCAGGAGGCGGCGGCCCCGGCTGGCCGTGGGGCTTGTGGATTTTTAAAAATTTGGCTCCG
AGGAGGACCATTTCCTCTCGACATGCATCCCTCCGGATAGACTGAACATCCCTCCGTTCA
CCCCCCCGCCCCGCGCGGTCAGAGGCAGGCGCTGAGTGTGCGAAGAGGATCCGGGTTGAA
ATCTGCGCCCCCGGTTCTCGTCCCCGCCCCGTCCCACCGCCCCATCCCCCTCCCGGAGTC
GAAATTTCCCGGGATTATGTTTCGGAAAGGTAGGTAAGCGCCGGGCGCGGCGCCCGCTTT
CCCGCAGTCCGGAGCCGGAGAGCCAGCGAGGCGGCGAGGCAGCCCCCGCGGCTTGCAGCG
GAGCCGACAGCTCGTCTTCTCTTCTGGAGGTGCAGCTGGTGGTCGGGGGGAGAGACTTGC
TCCAAACACGGACATCCCCCAGCTCTCCCCCCTCCCTGTTTTCCGTTAGGAACCCGGCGA
GGAAATACATGCACTGGCTGAGAATCGCCCGCGCCAGGGCGCAACGCCACAAGGTGTAGG
GAGTGTGCGGGGTGGGGCGAAAGGGGACCCAAGAGTCCCTGTGGCTCGGAGTGCCGGGCC
GTCGGTTCTTCATTCCTGCCCTCGGGGCAGACGGAGTGACCCCGGCCCCCACTCCCCGCC
CCGACCATGGTAGTGTTCAATGGCCTTCTTAAGATCAAAATCTGCGAGGCCGTGAGCTTG
AAGCCCACAGCCTGGTCGCTGCGCCATGCGGTGGGACCCCGGCCGCAGACTTTCCTTCTC
GACCCCTACATTGCCCTCAATGTGGACGACTCGCGCATCGGCCAAACGGCCACCAAGCAG
AAGACCAACAGCCCGGCCTGGCACGACGAGTTCGTCACCGATGTGTGCAACGGACGCAAG
ATCGAGCTGGCTGTCTTTCACGATGCCCCCATAGGCTACGACGACTTCGTGGCCAACTGC
ACCATCCAGTTTGAGGAGCTGCTGCAGAACGGGAGCCGCCACTTCGAGGACTGGATTGAT
CTGGAGCCAGAAGGAAGAGTGTATGTGATCATCGATCTCTCAGGGTCGTCGGGTGAAGCC
CCTAAAGACAATGAAGAGCGTGTGTTCAGGGAACGCATGCGGCCGAGGAAGCGGCAGGGG
GCCGTCAGGCGCAGGGTCCATCAGGTCAACGGCCACAAGTTCATGGCCACCTATCTTCGG
CAGCCCACCTACTGCTCCCATTGCAGAGACTTCATCTGGGGTGTCATAGGAAAGCAGGGA
TACCAGTGTCAAGTCTGCACCTGCGTGGTCCACAAGCGGTGCCACGAGCTCATAATCACA
AAGTGTGCTGGGTTAAAGAAGCAGGAGACCCCCGACCAGGTGGGCTCCCAGCGGTTCAGC
GTCAACATGCCCCACAAGTTCGGTATCCACAACTACAAGGTCCCTACCTTCTGCGATCAC
TGTGGGTCCCTGCTCTGGGGACTCTTGCGGCAGGGTTTGCAGTGTAAAGTCTGCAAAATG
AATGTTCACCGTCGATGTGAGACCAACGTGGCTCCCAACTGTGGAGTGGATGCCAGAGGA
ATCGCCAAAGTACTGGCCGACCTGGGCGTTACCCCAGACAAAATCACCAACAGCGGCCAG
AGAAGGAAAAAGCTCATTGCTGGTGCCGAGTCCCCGCAGCCTGCTTCTGGAAGCTCACCA
TCTGAGGAAGATCGATCCAAGTCAGCACCCACCTCCCCTTGTGACCAGGAAATAAAAGAA
CTTGAGAACAACATTCGGAAAGCCTTGTCATTTGACAACCGAGGAGAGGAGCACCGGGCA
GCATCGTCTCCTGATGGCCAGCTGATGAGCCCCGGTGAGAATGGCGAAGTCCGGCAAGGC
CAGGCCAAGCGCCTGGGCCTGGATGAGTTCAACTTCATCAAGGTGTTGGGCAAAGGCAGC
TTTGGCAAGGTCATGTTGGCAGAACTCAAGGGCAAAGATGAAGTATATGCTGTGAAGGTC
TTAAAGAAGGACGTCATCCTTCAGGATGATGACGTGGACTGCACAATGACAGAGAAGAGG
ATTTTGGCTCTGGCACGGAAACACCCGTACCTTACCCAACTCTACTGCTGCTTCCAGACC
AAGGGCACAGGATTTTCCATTCAAGGTTGTGCTTGTGAAGGGATGAGAGAGCTGTAGAAT
TCTTTGCAGCCAGAGTTGGACAAAGCCAAATGGCTAAACTCACTGTTTGCTCATTGGAAA
AACCAACAAGTGTGGTTAGTCCTTGCTCTGCTCCTAACTTTCTATCACTAATCAAATCAC
TTAACTTCTAAGTTATTTTCATGTCATATGAAAAAGAGTAAAGGCCACCTTAATCTCTTC
TAATCTGTGTAATGTCATCTGAAATAAAGGATGTGAACAAATGCTTAAAATTTCATAGTG
AAACACAAATATAAGGCAGCATTTTTAATTTACCGCATAGGTGTCTGGGAACCAGAAGGT
GGCAGTAAAGAAACAAAGATAATCCATAACTCCATGGTAGAGTCTGACTCGAGTATTATT
AACTAATTTGTTACCTGTTTTTAGTAAAGAAACAGCAATGTTCTTCATGAAGCTCTAATT
TTGTTATCCTTTTTGAGGGGTTGGGAGGAGTTAAAGTCTTTTAGGATCATTATGGATGTT
TGTAGTATTTTGCTTCTTGAGAAGGCAAAGACAGACATCACCTGAAACTCCTAGCTGTGG
CTTATGTGGAACCCAGACCCTGAGGGTGACATCATGGAGAGGTGATACCTTGCTTCTGGG
TGTATTCTCATCTCCATGTCATTTTGAATGCCAGTTTTTCCACTTAAAATTCAATAGTTA
TTCATTGAGTCATTTGGCAAACTTTTCTTTTATTATATTTCATTATATCCTTCCCGTGTA
TCTGATGCCATGCCAGGTGCTGGAGATACAGTGGTGAACTAGACTAGTCCCTGACCTCAT
GGAGTTTACATTATCTTTGGTACACCGTTTCCCAGAGAGGATTTCTCAGAACCCCAATCA
CTTGAGCAGCTGTAAGAAGAAAGGACTCTGTGACCCATAGTTGGAGTCACTGCAAACGTA
ACCTCTCTTAGTCTCAACACACGTATGTTTATTAGCATCCTTGAGGAGACCTGCAATGAA
AACAAAATTACCTTTGTTTAATCTACTTTTCCGAACTTATTTGATCCCAGGGTCCCCCAT
CTCTCTCTTACACACACATACACATGCACCCACACACACACAATGCCCATTCCATACTGA
GGAACCCTGATCCAGTGGAATTTTTCCTATCCTTCTGATCTCTCAGGAGAATAAGAAATA
TCGTCTGAAAATCTGGAAATCATTCTGCTTATCTTTCAAGATGGACACATATTTCTTTGT
CTACGAAACTTTCCTCAGAGACCACTATTTAATAGGAATCTATCCCTTTTTCTGCACAAG
TATAAGAATTACTAACTCTTCTCATTTTTCATGTGTGTTGTGTAATGCCTAATATTTATG
GGTTTGTGTGTGTACAGAATCCTGAATAATAGAGACTCAGTGATGGAGTTAACTTTCTTC
TTTTTTCCACTAGAGCATAATTTTAGATTCATGAGAAATGTATCATATTTTGTATTTTCC
ATGGTGCCTATCACAGGGCCTCACACTTGACAGGTACCCACGGACAGAATCAAAGACTTG
GAAGATTTTTTCAAAGTCACCTTATCTTTCTTTATCTCTCTCTCTTTTCCTTTCTTTTCT
TTTCCTTTTTTTTTTTCTTTTCTTTCCTTTTGGTACCAGTGAGAAAATTGGGTTTCAGAG
AAGTAAAACTATTTTGCTCATAGGCACTCCATCTTGGCAGAGTCAGACCTGGCATCTCAT
CTAGTCTCAGGGACTCCCAAGGTAGTGGGGCCTTGCTCTGATTCACATTGCTAGTTTCTT
GTGCCTGATCCAGCACAGGGTCCCTTCTGTTGGAGGAACCCTCCCACTTCCCCCTGTCCC
CAGCAGGTAGCCCTCCCTCTCACTATCTGAGGTGGCTTTCCAGGCAGGGAGCCACTCTGG
CAAGTTTTCTTTACACCATTATCAAGAAGCCCAACATCCTAGGAGGGGTCCAGTTTAGTT
GTGAGGGCTCTATGGAGCCCCTGTACGTGGTGGATCATGGGAAGCCACGTTGAAGGTCAG
CTTGGTGAATGAGTGAGGGAGTGGGAATGGATGTCTTCAATGTCAGCAGTGTTCTCCTTT
GTGCGTTGTAGAATAACAAGGCTAAGGATTCCTCATCATATGGCAGCTTTTGGAGCACAA
AATGGTGTTGAATAACACCAGGGATTTCTTTTATGGCAGAACAGTGATCAAGCTAACATG
GATGTTGTCATGGATGGCTGTAGGGTGAGGATGGGCAGAGAAGGAGCTTCCTCTGTAGTT
CAGATATTTACTATCTTTTCTCAGGCCACTGTCAGGCAGCCACAGTCACAGGAGCAGCTT
TGCACCAACTCTCTCATGCCACCTCAGTTTCATAGAATACTTAGCTTTATGTAACAGATG
CATATTCACTGAATTTTTCTAAACTGAATCATATTTTAACCTCATAGAAGGATCTTAACT
TACTTATGAAAGGAACCTGATGAAGAATCAGCTTATAAACCTTCAACTTAACTTTTTAAA
AATGTGACTTTCCCTATGACAAACCAACAGTTTATCATAGTTTTAAAGAGTAGCTATTAT
TCACCTGACTCTGAGGTAGATGCTGGGGTTATTAACCAAAGGAAGACAGTTCTCACGTGG
AAGGATTCACTGATAATAGATTGGGAGGTTATTCTAAATTCCACAAGCTAAGAGGGAGTA
GCAAACAGCATTGAATAGTTATGTTCTAGATGGGAGTATTCAAACCAAGAAGACTCAGGG
GAGGGGGTCTTCCCTACGATCTAGTGGAAGAAGTGCGATCAAGCCAGGCTTTGAAAGGTA
GAGAGGATTTGGACAGGATTTGGGAATAGCAGCTGGGTTTGGTAGCCACAGAATTCAGTC
TTGATTGAGTTTCACTTTTCCTGAAAACAAAGGACAGTTCCTCTGAGCCACCTTAAACCT
GGTTTCCACTAAGACTCTGATACAACATTCAGGAACACAAAGACCCGATTGCAATCCTAT
TAAGATTTCTTTCATGCTTGTTTAATTATGACATACAGAACAGCAATAATATTAAGTCGA
GTTTAATTATTTTTAGGTGAGCCTTTATTTTTCAATATATCGGAAAAAAATGGTCCTTTT
GGAAACATTCCTTTGAGAACTTCTTCTGAGAGATTAGACATTGCTTCAGACTGCACACTA
CATACAAGTTGCCTGGAAAGACTCAGAAGTGTGTAAAGTGATGTCACCATATCTAATACG
GTGACCAATGGCAATGGTCATATGAACCCATTGGCATCAGTCATGATGACATAGTCAGGT
TCAGGTCTGGTCAGTGCAGCCCAGTGAAGGGCCAACTTACAGCTGAAGAGAGATTTGGGC
TTTTCTTTACTGAGCCCGCCTACCCTTGGCTCATGTGCTCCATCCGCTCCATGGGATCTA
GAAAGGCAAAAAGCAAATAAAATGGCTCCAGCTTTCCAGGGCTAGTGAGAAAAAGCAGAC
AGAACAACAAATTAAGCCAGTGGTTTTAATTTCAGTCAAATTCAAACCAGTGTGTCTTTG
GGATGCAAGAGTAACCTGAACCATGTAGGGAATTCTACCAAACTTGATTTAATTTACTGT
CAAAATATAAAGTACAGAAAGAGGAATAAAGAACTTCTAATTCCAGTCAAGATCAAGTAG
CCACATTCGTCCCAGGTCCTCCCTCTTACAACTAAAAATCCCTGGACATAATTCTTATTT
TATAAAGGTAGGGTGCTTATCAGCTTATCAAAATTGGCATAGTCACAAAAAACTGTATCT
GTTGATGTGAATGAAAGACCAAAATTTTTATATTTAAAAATTCTAGAAGACTTTTAAGTG
GGTAACATTGTCAGTAGTGTTTAATATTTTCTTGCATATGAGAAAAAAAATTTTTTATAC
ATCCACAGTTGTTTCTTGCTATAAAAAAATTATGGCCTATAATTGTTTCAATTACAAGTC
TTTATTGTTAAGCATCTATGTGCTAGACACTGTGCTAGATTCTAGGGCTACAAAGCTAAA
AGATACCAACTCTGAACTCATGCCAATTACTGCCTAGTAGAGAGATAGACATGCAAGGAG
GCAGTCAGGAAGGTTTCCTGATGGAGGTAGAACCTACCCTGGACCTGGAAGCATGGGTGG
CATTTGCAAGAGGGTAGGGGTAAAGACATGGCTGCTGAAACCTAGAAATTATTTCCAAAT
CTCATTTGTATTATTTTTCCAATGCTTGAACTCCCAACCAATGCTATCTCCTACTTCTTC
CAAGGAAATGATAATGGCTAAACCAGAGCAAAGAAGGAAGAGGAGAAAGGGAGGGTATTT
GGAAAATAAGGAGACAGATTCCTGCATCTACAAGATCAGATGCCTATCGGTAGAGGAGGG
AGGTAATGCTGTGAGCCCTCCTTATTGGACTGCTAGGCTCTAAAACTTAGGGGCTTGGTC
AGGGTTTGTGGGGGAAGTGACTTTTGGAATTGCCTCTCCCAGTTCCCAGGTTCCCATTCA
GGCATTGACTACAAGGGATAGGAGAACCACTGAGAGGTAGTTTTGTTTTTTTTTTCTGGA
AGTTACAGGAAATGAAATTCCCAGATTTTTAGAGTCTGTGCATTTGTATTTATGACCCCC
ATTGTTGAAACCATTCTCTCCAACAGGATCCCACAAAACCTGTCTTGAATAATTTCATGA
TTTTTCCTCTTTAAAAATTTCATCTCTACACAATTCTACCCATCCCCCACCCTTTGGCAT
TTCCTGCCAGGCCTGGGAAGCCAAATTCTGGAGGGCTTTGCTGCAAAGGAAACAAAGGGT
GAACTAGAGAATCTCCCTTAGCCAATCTCCCTTGCTGCCCTAGGGAAAATGCAGCATGGA
AACATCCTTACAAAGCAACGGGAGACGTTTTTCAAATGCGTTTGAATCATCTGTGTGAGC
ACGGGGAGAAGTGAGAAAAGGAGTGTTAACAACGTAGGAGCAAAAGTGTCATTTCAAGGA
ACTCAACTCTGAAGAACAGAAACACTAAACCAAAAAAAAAAAAAAAAAAAAAAC

Protein Sequence

>5581 : length: 737
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKT
NSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLE
PEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQP
TYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVN
MPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIA
KVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELE
NNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFG
KVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKD
RLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILL
DAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEM
MAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGED
AIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQI
NQEEFKGFSYFGEDLMP