ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5578

Name

PRKCA

Synonym

AAG6|PKC-alpha|PKCA|PRKACA;protein kinase C, alpha;PRKCA;protein kinase C, alpha

Definition

PKC-A|aging-associated gene 6|protein kinase C alpha type

Position

17q22-q23.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Vascular smooth muscle contraction;KEGG PATHWAY;hsa04270

Pathway

Fc gamma R-mediated phagocytosis;KEGG PATHWAY;hsa04666

Pathway

Syndecan-4-mediated signaling events;PID Curated;200115

Pathway

Non-small cell lung cancer;KEGG PATHWAY;hsa05223

Pathway

Phosphatidylinositol signaling system;KEGG PATHWAY;hsa04070

Pathway

Integration of energy metabolism;Reactome;REACT:1505

Pathway

Vibrio cholerae infection;KEGG PATHWAY;hsa05110

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

VEGFR1 specific signals;PID Curated;200151

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

5HT2 type receptor mediated signaling pathway;PANTHER;P04374

Pathway

Muscarinic acetylcholine receptor 1 and 3 signaling pathway;PANTHER;P00042

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

TCR signaling in naive CD4+ T cells;PID Curated;200022

Pathway

Thyrotropin-releasing hormone receptor signaling pathway;PANTHER;P04394

Pathway

Salivary secretion;KEGG PATHWAY;hsa04970

Pathway

telomeres telomerase cellular aging and immortality;PID BioCarta;100021

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

ATF-2 transcription factor network;PID Curated;200116

Pathway

Ras signaling in the CD4+ TCR pathway;PID Curated;200088

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Amoebiasis;KEGG PATHWAY;hsa05146

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

Opioid Signalling;Reactome;REACT:15295

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Endothelin signaling pathway;PANTHER;P00019

Pathway

Diabetes pathways;Reactome;REACT:15380

Pathway

Alpha adrenergic receptor signaling pathway;PANTHER;P00002

Pathway

ionomycin and phorbal ester signaling pathway;PID BioCarta;100121

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

Endothelins;PID Curated;200004

Pathway

TCR signaling in naive CD8+ T cells;PID Curated;200062

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Aldosterone-regulated sodium reabsorption;KEGG PATHWAY;hsa04960

Pathway

Regulation of Insulin Secretion by Acetylcholine;PID Reactome;500136

Pathway

Pathogenic Escherichia coli infection;KEGG PATHWAY;hsa05130

Pathway

Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway;PANTHER;P00027

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

bioactive peptide induced signaling pathway;PID BioCarta;100226

Pathway

VEGF signaling pathway;KEGG PATHWAY;hsa04370

Pathway

Histamine H1 receptor mediated signaling pathway;PANTHER;P04385

Pathway

VEGF signaling pathway;PANTHER;P00056

Pathway

Long-term potentiation;KEGG PATHWAY;hsa04720

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664

Pathway

keratinocyte differentiation;PID BioCarta;100119

Pathway

Downstream signaling in naive CD8+ T cells;PID Curated;200184

Pathway

Thromboxane A2 receptor signaling;PID Curated;200069

Pathway

Canonical NF-kappaB pathway;PID Curated;200026

Pathway

Calcium signaling pathway;KEGG PATHWAY;hsa04020

Pathway

Angiogenesis;PANTHER;P00005

Pathway

a6b1 and a6b4 Integrin signaling;PID Curated;200162

Pathway

GnRH signaling pathway;KEGG PATHWAY;hsa04912

Pathway

mTOR signaling pathway;PID Curated;200080

Pathway

Alzheimer disease-amyloid secretase pathway;PANTHER;P00003

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

Pancreatic secretion;KEGG PATHWAY;hsa04972

Pathway

Gap junction;KEGG PATHWAY;hsa04540

Pathway

Oxytocin receptor mediated signaling pathway;PANTHER;P04391

Pathway

Retinoic acid receptors-mediated signaling;PID Curated;200142

Pathway

Gastric acid secretion;KEGG PATHWAY;hsa04971

Pathway

Role of Calcineurin-dependent NFAT signaling in lymphocytes;PID Curated;200076

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

Long-term depression;KEGG PATHWAY;hsa04730

Pathway

Signaling events regulated by Ret tyrosine kinase;PID Curated;200058

Pathway

Synaptic Transmission;Reactome;REACT:13685

Pathway

Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650

Disease

Pituitary tumor, invasive;OMIM

Disease

multiple sclerosis;GAD

Disease

IMMUNE;GAD

External Links

Links to cell senescence gene database

5578

Links to epithelial mesenchymal transition gene database

5578

Links to ovarian cancer gene database

5578

Links to endometrial cancer gene database

5578

Links to iHOP

5578

Sequence Information

Nucleotide Sequence

>5578 : length: 8844
CCGCCCCCGCCCACCCGGCCCTCCGCGGCCGCAGCTCCCCGGCGGAGGCAAGAGGTGGTT
GGGGGGGACCATGGCTGACGTTTTCCCGGGCAACGACTCCACGGCGTCTCAGGACGTGGC
CAACCGCTTCGCCCGCAAAGGGGCGCTGAGGCAGAAGAACGTGCACGAGGTGAAGGACCA
CAAATTCATCGCGCGCTTCTTCAAGCAGCCCACCTTCTGCAGCCACTGCACCGACTTCAT
CTGGGGGTTTGGGAAACAAGGCTTCCAGTGCCAAGTTTGCTGTTTTGTGGTCCACAAGAG
GTGCCATGAATTTGTTACTTTTTCTTGTCCGGGTGCGGATAAGGGACCCGACACTGATGA
CCCCAGGAGCAAGCACAAGTTCAAAATCCACACTTACGGAAGCCCCACCTTCTGCGATCA
CTGTGGGTCACTGCTCTATGGACTTATCCATCAAGGGATGAAATGTGACACCTGCGATAT
GAACGTTCACAAGCAATGCGTCATCAATGTCCCCAGCCTCTGCGGAATGGATCACACTGA
GAAGAGGGGGCGGATTTACCTAAAGGCTGAGGTTGCTGATGAAAAGCTCCATGTCACAGT
ACGAGATGCAAAAAATCTAATCCCTATGGATCCAAACGGGCTTTCAGATCCTTATGTGAA
GCTGAAACTTATTCCTGATCCCAAGAATGAAAGCAAGCAAAAAACCAAAACCATCCGCTC
CACACTAAATCCGCAGTGGAATGAGTCCTTTACATTCAAATTGAAACCTTCAGACAAAGA
CCGACGACTGTCTGTAGAAATCTGGGACTGGGATCGAACAACAAGGAATGACTTCATGGG
ATCCCTTTCCTTTGGAGTTTCGGAGCTGATGAAGATGCCGGCCAGTGGATGGTACAAGTT
GCTTAACCAAGAAGAAGGTGAGTACTACAACGTACCCATTCCGGAAGGGGACGAGGAAGG
AAACATGGAACTCAGGCAGAAATTCGAGAAAGCCAAACTTGGCCCTGCTGGCAACAAAGT
CATCAGTCCCTCTGAAGACAGGAAACAACCTTCCAACAACCTTGACCGAGTGAAACTCAC
GGACTTCAATTTCCTCATGGTGTTGGGAAAGGGGAGTTTTGGAAAGGTGATGCTTGCCGA
CAGGAAGGGCACAGAAGAACTGTATGCAATCAAAATCCTGAAGAAGGATGTGGTGATTCA
GGATGATGACGTGGAGTGCACCATGGTAGAAAAGCGAGTCTTGGCCCTGCTTGACAAACC
CCCGTTCTTGACGCAGCTGCACTCCTGCTTCCAGACAGTGGATCGGCTGTACTTCGTCAT
GGAATATGTCAACGGTGGGGACCTCATGTACCACATTCAGCAAGTAGGAAAATTTAAGGA
ACCACAAGCAGTATTCTATGCGGCAGAGATTTCCATCGGATTGTTCTTTCTTCATAAAAG
AGGAATCATTTATAGGGATCTGAAGTTAGATAACGTCATGTTGGATTCAGAAGGACATAT
CAAAATTGCTGACTTTGGGATGTGCAAGGAACACATGATGGATGGAGTCACGACCAGGAC
CTTCTGTGGGACTCCAGATTATATCGCCCCAGAGATAATCGCTTATCAGCCGTATGGAAA
ATCTGTGGACTGGTGGGCCTATGGCGTCCTGTTGTATGAAATGCTTGCCGGGCAGCCTCC
ATTTGATGGTGAAGATGAAGACGAGCTATTTCAGTCTATCATGGAGCACAACGTTTCCTA
TCCAAAATCCTTGTCCAAGGAGGCTGTTTCTGTCTGCAAAGGACTGATGACCAAACACCC
AGCCAAGCGGCTGGGCTGTGGGCCTGAGGGGGAGAGGGACGTGAGAGAGCATGCCTTCTT
CCGGAGGATCGACTGGGAAAAACTGGAGAACAGGGAGATCCAGCCACCATTCAAGCCCAA
AGTGACTTTGTGTACCAAAATGCACTGGCTTCAGTGGGCCTCCAGGTCTTCGTGTGGCAA
AGGAGCAGAGAACTTTGACAAGTTCTTCACACGAGGACAGCCCGTCTTAACACCACCTGA
TCAGCTGGTTATTGCTAACATAGACCAGTCTGATTTTGAAGGGTTCTCGTATGTCAACCC
CCAGTTTGTGCACCCCATCTTACAGAGTGCAGTATGAAACTCACCAGCGAGAACAAACAC
CTCCCCAGCCCCCAGCCCTCCCCGCAGTGGGAAGTGAATCCTTAACCCTAAAATTTTAAG
GCCACGGCCTTGTGTCTGATTCCATATGGAGGCCTGAAAATTGTAGGGTTATTAGTCCAA
ATGTGATCAACTGTTCAGGGTCTCTCTCTTACAACCAAGAACATTATCTTAGTGGAAGAT
GGTACGTCATGCTCAGTGTCCAGTTTAATTCTGTAGAAGTTACGTCTGGCTCTAGGTTAA
CCCTTCCTAGAAAGCAAGCAGACTGTTGCCCCATTTTGGGTACAATTTGATATACTTTCC
ATACCCTCCATCTGTGGATTTTTCAGCATTGGAATCCCCCAACCAGAGATGTTAAAGTGA
GCCTGTCCCAGGAAACATCTCCACCCAAGACGTCTTTGGAATCCAAGAACAGGAAGCCAA
GAGAGTGAGCAGGGAGGGATTGGGGGTGGGGGAGGCCTCAAAATACCGACTGCGTCCATT
CTCTGCCTCCATGGAAACAGCCCCTAGAATCTGAAAGGCCGGGATAAACCTAATCACTGT
TCCCAAACATTGACAAATCCTAACCCAACCATGGTCCAGCAGTTACCAGTTTAAACAAAA
AAACCTCAGATGAGTGTTGGGTGAATCTGTCATCTGGTACCCTCCTTGGTTGATAACTGT
CTTGATACTTTTCATTCTTTGTAAGAGGCCAAATCGTCTAAGGACGTTGCTGAACAAGCG
TGTGAAATCATTTCAGATCAAGGATAAGCCAGTGTGTACATATGTTCATTTTAATCTCTG
GGAGATTATTTTTCCATCCAGGGTGCCATCAGTAATCATGCCACTACTCACCAGTGTTGT
TCACCAACACCCACCCCCACACACACCAACATTTTGCTGCCTACCTTGTTATCCTTCTCA
AGAAGCTGAAGTGTACGCCCTCTCCCCTTTTGTGCTTATTTATTTAATAGGCTGCAGTGT
CGCTTATGAAAGTACGATGTACAGTAACTTAATGGAAGTGCTGACTCTAGCATCAGCCTC
TACCGATTGATTTTCCTCCCTTCTCTAGCCCTGGATGTCCACTTAGGGATAAAAAGAATA
TGGTTTTGGTTCCCATTTCTAGTTCACGTTGAATGACAGGCCTGGAGCTGTAGAATCAGG
AAACCCGGATGCCTAACAGCTCAAAGATGTTTTGTTAATAGAAGGATTTTAATACGTTTT
GCAAATGCATCATGCAATGAATTTTGCATGTTTATAATAAACCTTAATAACAAGTGAATC
TATATTATTGATATAATCGTATCAAGTATAAAGAGAGTATTATAATAATTTTATAAGACA
CAATTGTGCTCTATTTGTGCAGGTTCTTGTTTCTAATCCTCTTTTCTAATTAAGTTTTAG
CTGAATCCCTTGCTTCTGTGCTTTCCCTCCCTGCACATGGGCACTGTATCAGATAGATTA
CTTTTTAAATGTAGATAAAATTTCAAAAATGAATGGCTAGTTTACGTGATAGATTAGGCT
CTTACTACATATGTGTGTGTATATATATGTATTTGATTCTACCTGCAAACAAATTTTTAT
TGGTGAGGACTATTTTTGAGCTGACACTCCCTCTTAGTTTCTTCATGTCACCTTTCGTCC
TGGTTCCTCCGCCACTCTTCCTCTTGGGGACAACAGGAAGTGTCTGATTCCAGTCTGCCT
AGTACGTTGGTACACACGTGGCATTGCCGCAGCACCTGGGCTGACCTTTGTGTGTGCGTG
TGTGTGTGTTTCCTTCTTCCCTTCAGCCTGTGACTGTTGCTGACTCCAGGGGTGGGAGGG
ATGGGGAGACTCCCCTCTTGCTGTGTGTACTGGACACGCAGGAAGCATGCTGTCTTGCTG
CCTCTGCAACGACCTGTCGTTTGCTCCAGCATGCACAAACTTCGTGAGACCAACACAGCC
GTGCCCTGCAGGCACCAGCACGTGCTTTTCAGAGGCTGCGGACTTTCTTCCAGCCATTGT
GGCATTGGCCTTTCCAGTCTTGGGAGGAGCGCGCTGCTTTGGTGAGACACCCCCATGCAA
GGTCCTCAGAGTAGCCGGGTTCTACCACAAACAGAAACAGAATGAAAGTAGCTGTCAGTC
CTTGTAGAGAGCCGCTCTGTTTCCTCCCAGAAGCATCTCCCAGCTAAGCTCGCATTATTT
TTCTCCTCTGGCTGTTTGCCTGAAGTTCACAGAACACACAACCATGAAAGGCTTTTTGAG
GTGAGAGGCCCAGGTGGTCCTGGCAACCCTGAGTAGAAGGAGAGACGGGGTAGGGAACGG
GCCCGGCCAGAAAAGAACCATTTCTTCTGCCATCTTTTATGCACCATAGACATCGAGACT
CCAGGGGGTCCTGGCTCCCCTGTCCCTGCAGCCCTGCAGGTCAGTGCATGATCTGGGTTC
GTGTCCTGACCAGGTGCTCCTCCTTTGATCCGAGGGGAAAGGGACTGGTTTATAGAAAGA
GCCTAGGAGACAAAAGGGCCAGTCCCCCTGCCCAGAATGGAGCAGCAGCAGGACAGACCC
CCACGAGGCCCCCCAGAGAGGAGGAAGATCCCACGGAGGAACACATGAGGTTAGGGACCC
TTGTTCAGCACCCCAAACAGCCTGCCTGTTTAAAGCAGGCAGCAGGCTTAGGCCTTCCCT
GCAACCCCAACACCCACAAGTTTGTTTCTCTAGGAAACACATTCACTGTCTCAGCTGGCT
GTTACTCTCTCAGACCATATGGCAAAGTTTTCCAAGAAAATGCCCCGACAGGGGTGCCCA
GCACACTGCCTGAGGGACAACAGACATCAGAACAAACCCCCAGAGAGAAACAGTCAAAAT
CAGGGCCCGGTGCAGTGTTGTCATGTGGAACCTGCTTTATCCATTGCTGAGTGTTGAATG
TGGGTAATGGTTAGGGCTTTCCAGATCTCAGCAGCCAAAGACAGTTATTGTTGGAAGACT
GTCATGTAGATAACCATGAGCAATGGCTCGCCTCAGAATCAGTTCATAAAATTCTATGGT
ACTGGCCCCTTCGTGGGTATTGTGTGAAATGAGATGGTGGCGAGGGGTGCGCTGTGGAAC
TGCCGCAGCCACGCAGGAGGTCCCTGGGGGATGCTTTGGGAAGTCCTTGCCCCTGAGCAC
TGCCTGATTGCCAGGGCCTGTGGAGGTCTAGGCCGCCTGGCAGAATCTAGCACCGTCCGA
ATCCCCGCAGGACCCATGGAGCTATGACCACACCAGGCCATTCAAATGGCTCTGCATTAT
CTTCCCTTGGAAGGTGGCCACTCCTCGGTGGCAGGGCCTTTCCCTGAGGCTGCAGGCCGT
GGGCTGGCAGCCCGTCTCTTGGCATTTCAATTGAAGGTCACCAGGTGCTGGGTTTGAAAG
GAAGTCACTGGAGTGCTGCCAGGGGCCGCCCTCCAAGGTTAATGAGAGGCCCACATCCAG
GCAAGAACTAATTCAAAAGGCAGATCAGAAACCACAGGAGTCAAAATTATTGCTCCGGCA
GTGCTTCCCTTCCTTTCATCCACTGGCCTCGTGTGGTCCATGCAGGGCCACTGTCTGCCC
TTTCTGATGCCACGTATTAGGCTTTCTTACTCAGAATTTTGATAGAAAACCATGGGGCCA
AGAGCTCTGGAAGCCTGGCCGGAAAGACCAAGGTTCATGCAGCCCAACAAATGATTGTTG
AGCACCTCTCGGAGCCAAAGTCCTTAGGCGAGTGTGGTGACTTCCTGGAAGGAGGATGCA
GACTTCCAGAGAGCCCCCCCAACGGACGTGCTGAGAAGGGAGAGGGAGGCGGGGGCTGTA
GTCAGGAAGGAGCCAGAGAAGAACAGGGTTTGGGTGCATCCAGAAATATGCCTGCAGTAG
GAGGGAGAGGAAGGGGTGCCACCGTCAACGGCTTCCCATCGGAGGTGGTTGGTGCAGATG
GAAGTTTCTGTCTGCTGGCCCTCAAGAGAGTGTTTTGCCAGGGACACAGTCTGTTCCTCC
TCAGAAAACACCCCCCAAATGCTAACAACATCCCCACCAGCTGCTAGAAGCCCCTTTCCC
CTCCCCACCTTGAAGTAGCTCATAGTTCTCTGGGCAGAGCCAGACCATCCAGTGTACCCC
AGAGGCCAGTAGGTTCCTGCCCATTTTCCTCTCTGGCTTCCTGCCAAGAATTATGGCAGC
TGAGGATGAATGGAGAAGTAAAAACAACTAACACCGCACAACTAACAACTAACACCGCAG
TTCCCACCTGGGTTCCACTTAGCAGGAGACATTTCGGAGGGTTTTTTTTGTTTTTGTTCC
TGTTTTTTTTTTTTTTGCTGGAATTTGTTTTCTCAGTACTGAAAAGAGAAAAAGTGACAA
TCTTGTATTTTTAAAAGCCTCGGAAAGGTGATACCATCTGACAGTCATTTTCTCACGTTG
GTCTTCTAAAGTCACCTATTTCTTGTGTGTGCACATCACACCATTTCCTGTTTCTTTATA
ACCCGACAAGGGTAGGAGTGCCTGTTTCCCCTGCTGGGCACACCAGACAATCGTAATCAC
AAAACAGACACTGAGCCAGGGGCCCAAAGGGTGTGATCATGAGAGTTACCGGGACAGCAG
TAGGCATGACAGTCACCAGGAAGGACAAGGGTGCTCTGTTGTTAGTGGCCACACACCAAT
TTGACAAGGAGTGTTGCGAAATTTTTATTTATTTATTTATTTATTTTGAGATGGAGTTTC
ACTCTTGTTGCCCAGGCTGGAGTGCGGTGGTACAATCTCGGCTCACTGCAACCTCCACCT
CCCAGGTTCAAGCGATTCTCCTGCCTCAGCCTCCCAAGTACCTGGGACTACAGGTGCGTG
CCACCACACCCAGCTAAATTTTGTGTTTTTAGTAGAGATGGGGTTTCACCATGTTGGCCA
GGATGGTCTTGAACCCCTGACCTCATGATCTGCCTGCCTCGGCCTCCCAAAGTGCTGGGA
TTACAGGCATGAGCCACCACGCCCAGCCAAAATATTTTTTTAAAGTCATTTTCCTTAAGC
TGCTTGGGCTACATGTGAAATACACTGGACGGTCAACATTCCTGTCTCCTCCCATTTGGG
CTGATGCAGCAGATCCAGGGAATGTTACCTGTTTCTGCTGCTAGAAGATCCAGGAAATTG
GGAAGGTTACCTGACGCACACATGGATGAAGGCCATCATCTAGAAATGGGGTCAACCACA
ATTGTGTTAATTCCGTAGTGTCAGGGATTCTTCGGGAAGGTCAACAGTATGAAGGATTCT
GACCCCTGTGCCTCCCATTTATGTGATCAGGTGACAGTTAATAACCGTGGAGGTCACACT
CAGCCATCCAACAGCCTTACAGTGACCCTACACAAAAGCCCCCAAATTCCAAAGACTTTT
TCTTAACCTAAAGGAAGAAATTATTTGTTAATTCCAGTAGAGCAACTGAATATACTGGGC
TATTTGTACTTTTTTATAGAGAACTTTAATAATAATTCTTTAAAAATGAGTTTTTAGAAC
AAAGCAACTGACGATTTCCTAAGATTCCAATGCCCTGGAGCTTGTAGGAGGACTTAGCCT
GGGTCAGCTGGAGCACCCCCGACCTGATCTCCCACTGCCAGATTTTCCCATGCTCCTAGG
GTATGGAGTCCACGTGGGAATGACTGCAAGTTCAGGTGGAACTTGGCCGACTGATGCTCT
GCGAGTTTTTAATAGACACTGGGGACAACTGCTTAAGGTTTAGAAACTTCCAAACCACAG
GAAAGACATTTTTAGTGTCCCCCATCCAGAGGCAGCCCTGGAATAGGATTCCCAGGGGTT
TCTGGGACCCCTTTCCTTGCTCCGTGAGGCTCTGTGGCCATCTTTTGGCAGGAGGAGGAT
GCTTCCTTGGCTCTGTGCCCAGACCCGCCTGGTCCCCAGGTCTCTCACCTTGGGTGAAGA
TTCAGAGATGCCCTGTAAGGATTTTGCCCACTGGGCAACTCAGAAATACTTCGATCTCCC
AAGATATAAGAGGCAGCAGCAAACGTGCCTATTGACGTCTGTTTCATAGTTACCACTTAC
GCGAGTAGACAGAACTCGGCTTTTCAGAAAATAGGTGTCAAGTCCACTTTATAAGAACCT
TTTTTTCTAAAATAAGATAAAAGGTGGCTTTGCATTTTCTGATTAAACGACTGTGTCTTT
GTCACCTCTGCTTAACTTTAGGAGTATCCATTCCTGTGATTGTAGACTTTTGTTGATATT
CTTCCTGGAAGAATATCATTCTTTTCTTGAAGGGTTGGTTTACTAGAATATTCAAAATCA
ATCATGAAGGCAGTTACTATTTTGAGTCTAAAGGTTTTCTAAAAATTAACCTCACATCCC
TTCTGTTAGGGTCTTTCAGAATATCTTTTATAAACAGAAGCATTTGAAGTCATTGCTTTT
GCTACATGATTTGTGTGTGTGAAGGACATACCACGTTTAAATCATTAATTGAAAAACATC
ATATAAGCCCCAACTTTGTTTGGAGGAAGAGACGGAGGTTGAGGTTTTTCCTTCTGTATA
AGCACCTACTGACAAAATGTAGAGGCCATTCAACCGTCAAACACCATTTGGTTATATCGC
AGAGGAGACGGATGTGTAAATTACTGCATTGCTTTTTTTTTCAGTTTGTATAACCTCTAA
TCTCCGTTTGCATGATACGCTTTGTTAGAAACATTAATTGTAGTTTGGAAGCAAGTGTGT
ATGAATAAAGATAATGATCATTCC

Protein Sequence

>5578 : length: 688
MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVTLCTKMHWLQWASRSSCGKGAENFDKFFTRGQPVLTPPDQLV
IANIDQSDFEGFSYVNPQFVHPILQSAV