ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

55656

Name

INTS8

Synonym

C8orf52|INT8;integrator complex subunit 8;INTS8;integrator complex subunit 8

Definition

protein kaonashi-1

Position

8q22.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

55656

Links to epithelial mesenchymal transition gene database

55656

Links to ovarian cancer gene database

55656

Links to endometrial cancer gene database

55656

Links to iHOP

55656

Sequence Information

Nucleotide Sequence

>55656 : length: 3583
ATTTTGGATTGTGTGAGTTTCCGGGACGTTCGGAGGGTGGCCTCTCTCCCACCGGGTTCC
GCATACCCCAGGCACCGGCCCGCATCCAAGTGTCAGGTTGGAGCCGGGAAGCGGCCCTGG
TGGTAGCGGCGGCGGGGGCAGGATGAGCGCGGAGGCGGCGGACCGGGAGGCGGCCACCTC
CAGCCGGCCCTGCACCCCGCCGCAGACCTGCTGGTTTGAGTTTCTGCTGGAGGAGTCACT
GTTGGAGAAACATCTGCGCAAGCCCTGCCCGGATCCTGCACCAGTTCAACTTATAGTTCA
GTTTTTGGAACAGGCTTCCAAACCTTCAGTTAATGAACAAAACCAAGTTCAACCTCCGCC
TGATAACAAGAGAAATCGTATTTTAAAACTACTTGCTCTTAAAGTTGCTGCACATTTGAA
GTGGGACTTAGACATATTAGAGAAAAGTTTGTCTGTTCCAGTATTGAATATGCTACTAAA
TGAACTACTCTGCATCAGTAAAGTTCCTCCTGGGACAAAGCATGTAGACATGGATCTGGC
CACTTTACCTCCGACCACTGCCATGGCTGTACTTCTCTATAATAGATGGGCAATTAGGAC
AATTGTTCAAAGTAGTTTTCCAGTCAAACAGGCAAAACCCGGACCCCCTCAGTTAAGTGT
TATGAATCAAATGCAACAGGAAAAAGAGCTAACAGAAAACATTTTGAAAGTGCTCAAAGA
ACAAGCTGCTGATTCTATTTTGGTACTAGAAGCAGCCCTAAAATTAAACAAGGATCTTTA
TGTCCATACGATGAGAACTCTAGATTTATTGGCCATGGAACCAGGCATGGTAAATGGAGA
AACTGAGAGTTCTACTGCTGGATTGAAAGTCAAAACCGAAGAAATGCAGTGCCAGGTGTG
CTATGATTTGGGCGCAGCATACTTCCAGCAAGGCTCCACAAATTCAGCTGTCTATGAAAA
TGCCAGGGAAAAATTTTTTAGAACCAAAGAACTAATTGCAGAGATAGGTTCATTATCTCT
TCATTGTACCATAGATGAGAAGCGGTTAGCTGGCTATTGTCAAGCATGTGATGTTCTTGT
ACCTTCTTCTGATAGTACATCTCAACAGTTGACTCCATATAGTCAAGTCCATATTTGTTT
GAGATCTGGCAACTATCAGGAGGTAATACAGATTTTCATTGAAGACAACTTAACCTTGAG
TTTACCTGTCCAGTTCCGACAGTCAGTCCTAAGAGAACTCTTTAAGAAAGCTCAACAGGG
AAATGAAGCTCTAGATGAAATCTGTTTTAAAGTTTGTGCCTGTAATACAGTCCGTGATAT
ACTGGAAGGCAGAACAATTAGTGTTCAATTTAACCAGCTATTTCTTAGACCAAATAAAGA
GAAAATAGACTTTCTTCTTGAGGTATGTTCAAGATCAGTAAATTTAGAAAAAGCTTCAGA
GTCTTTGAAAGGAAACATGGCTGCTTTTCTAAAGAATGTGTGTCTGGGGTTGGAAGATCT
GCAGTATGTTTTCATGATTTCTTCACATGAGCTTTTCATTACATTGTTGAAAGATGAAGA
ACGAAAGCTACTTGTTGATCAGATGAGGAAGAGATCCCCTAGAGTAAATCTGTGCATTAA
ACCTGTAACTTCATTTTATGATATCCCAGCTTCAGCAAGTGTCAACATTGGTCAGTTAGA
GCATCAACTTATATTGTCAGTGGATCCTTGGAGGATTAGACAAATTTTAATTGAATTACA
TGGTATGACTTCAGAGCGCCAGTTCTGGACAGTGTCTAATAAGTGGGAAGTACCTTCTGT
CTATAGTGGTGTTATCCTGGGAATTAAAGACAATTTAACAAGAGATTTGGTTTATATTCT
TATGGCCAAAGGTTTGCACTGCAGTACTGTTAAGGACTTTTCCCATGCTAAACAGCTCTT
TGCTGCTTGTTTGGAGTTGGTAACAGAGTTCTCACCGAAGCTTCGTCAGGTCATGCTGAA
TGAGATGTTGCTTTTGGATATTCATACACACGAAGCTGGGACAGGGCAGGCAGGAGAGAG
ACCGCCATCCGACCTTATAAGTAGAGTACGAGGCTATCTGGAAATGAGGCTTCCTGATAT
TCCTCTTCGTCAAGTTATAGCTGAGGAATGTGTTGCCTTTATGTTAAACTGGAGAGAAAA
TGAATACCTTACACTCCAAGTTCCTGCATTTTTGCTTCAGAGTAATCCATATGTAAAGCT
TGGACAGCTTTTAGCAGCTACATGCAAAGAACTTCCAGGCCCTAAAGAAAGTAGACGGAC
TGCCAAAGACCTTTGGGAAGTTGTTGTTCAAATCTGTAGTGTGTCCAGTCAGCACAAACG
AGGAAATGATGGCAGAGTTAGTTTAATAAAACAGAGGGAATCTACGTTAGGTATCATGTA
TCGGTATGTATTGGAGTGAACTGCTTTCTTTTATCAAAAAATTACGAGGACAGGGTCTTG
ATCTGTCACCCAAGCTGGAGTGCTGAGGTGAACCACTCGTTTTGACTATTATTTTATCAC
TCTTTGTGAAACTTCACAATGTTCGGGAGGACATTGTGAATGATATTACAGCTGAACACA
TTTCTATTTGGCCATCTTCCATTCCCAAACATCACGTTGCTTTGTCGCCCAGGCTGGAGT
GCAGTGGTGAGGTCTCAGCTCACTGCAACCTACGCCTGCAAGGTTCAAGCGATTCTCATG
CCTCAGCCTGCCAAGTATCTGGGATTACAGCCTCCAGTCTGTGGACTTTGAAGCTGTGGC
AATCACAGTGAAAGAGCTAGTTCGATATACACTCAGTATAAATCCAAATAACCATTCTTG
GTTAATTATCCAGGCAGATATTTACTTTGCAACGAATCAGTATTCAGCAGCTCTTCACTA
TTACCTCCAGGCAGGAGCTGTGTGTTCTGACTTCTTTAACAAGGCTGTGCCCCCTGATGT
TTATACAGACCAGGTAATAAAACGAATGATAAAATGTTGTTCTTTGCTGAATTGCCACAC
ACAGGTGGCCATTTTATGTCAGTTCCTCAGAGAAATTGACTACAAAACAGCGTTTAAATC
TCTGCAAGAACAAAACAGTCATGATGCTATGGACTCCTACTACGACTACATATGGGATGT
TACCATTTTGGAATACTTGACTTATCTTCATCATAAAAGAGGAGAAACAGATAAAAGACA
AATTGCAATCAAAGCCATCGGCCAGACAGAGTTGAATGCAAGCAATCCAGAAGAAGTGTT
ACAGCTGGCAGCGCAGAGAAGGAAAAAAAAGTTTCTCCAAGCAATGGCAAAACTTTACTT
TTAAGCAGTTAAATTTTTTTAACTTTTATTTTTTAAACAATGGGCTAAAAATAAACAGTA
TTAAAAGGTTAAGTTTATATAATACATATGTACACAATTAGTGGTGTTTTCTTTTCAGAC
AAAATACTGAAACAAATATTAGTTTAAAAACAAACTATACAGAAGACTTCATACCGTAAC
AATAAATGTATAGTTTCTTCAAAGGGAGAAGAGATTCACATATCTGATAACAAAATAAAC
TAGCAATCTAGTTTTCTAATCTAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>55656 : length: 995
MSAEAADREAATSSRPCTPPQTCWFEFLLEESLLEKHLRKPCPDPAPVQLIVQFLEQASK
PSVNEQNQVQPPPDNKRNRILKLLALKVAAHLKWDLDILEKSLSVPVLNMLLNELLCISK
VPPGTKHVDMDLATLPPTTAMAVLLYNRWAIRTIVQSSFPVKQAKPGPPQLSVMNQMQQE
KELTENILKVLKEQAADSILVLEAALKLNKDLYVHTMRTLDLLAMEPGMVNGETESSTAG
LKVKTEEMQCQVCYDLGAAYFQQGSTNSAVYENAREKFFRTKELIAEIGSLSLHCTIDEK
RLAGYCQACDVLVPSSDSTSQQLTPYSQVHICLRSGNYQEVIQIFIEDNLTLSLPVQFRQ
SVLRELFKKAQQGNEALDEICFKVCACNTVRDILEGRTISVQFNQLFLRPNKEKIDFLLE
VCSRSVNLEKASESLKGNMAAFLKNVCLGLEDLQYVFMISSHELFITLLKDEERKLLVDQ
MRKRSPRVNLCIKPVTSFYDIPASASVNIGQLEHQLILSVDPWRIRQILIELHGMTSERQ
FWTVSNKWEVPSVYSGVILGIKDNLTRDLVYILMAKGLHCSTVKDFSHAKQLFAACLELV
TEFSPKLRQVMLNEMLLLDIHTHEAGTGQAGERPPSDLISRVRGYLEMRLPDIPLRQVIA
EECVAFMLNWRENEYLTLQVPAFLLQSNPYVKLGQLLAATCKELPGPKESRRTAKDLWEV
VVQICSVSSQHKRGNDGRVSLIKQRESTLGIMYRSELLSFIKKLREPLVLTIILSLFVKL
HNVREDIVNDITAEHISIWPSSIPNLQSVDFEAVAITVKELVRYTLSINPNNHSWLIIQA
DIYFATNQYSAALHYYLQAGAVCSDFFNKAVPPDVYTDQVIKRMIKCCSLLNCHTQVAIL
CQFLREIDYKTAFKSLQEQNSHDAMDSYYDYIWDVTILEYLTYLHHKRGETDKRQIAIKA
IGQTELNASNPEEVLQLAAQRRKKKFLQAMAKLYF