ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

55568

Name

GALNT10

Synonym

GALNACT10|PPGALNACT10|PPGANTASE10;polypeptide N-acetylgalactosaminyltransferase 10;GALNT10;polypeptide N-acetylgalactosaminyltransferase 10

Definition

GalNAc transferase 10|UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 10|UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10)

Position

5q33.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

O-Glycan biosynthesis;KEGG PATHWAY;hsa00512

Pathway

Metabolic pathways;KEGG PATHWAY;hsa01100

External Links

Links to cell senescence gene database

55568

Links to epithelial mesenchymal transition gene database

55568

Links to ovarian cancer gene database

55568

Links to endometrial cancer gene database

55568

Links to iHOP

55568

Sequence Information

Nucleotide Sequence

>55568 : length: 5966
GTTGGAGCGGGGCCGGCGCCGCAGCCGCTTCTGCTGGCTGAGCTGCTGCCGCCGCCGGGC
GGACGGGCGGACGCGCGGAGCTGGGGGCGGCGCGGCGGGGCCGGCGGGGCGCGGCGGGGC
TGACCGGCCCCGATGAGGCGGAAGGAGAAGCGGCTCCTGCAGGCGGTGGCGCTGGTGCTG
GCGGCCCTGGTCCTCCTGCCCAACGTGGGGCTTTGGGCGCTGTACCGCGAGCGGCAGCCC
GACGGCACCCCTGGGGGATCGGGGGCGGCGGTGGCGCCGGCGGCGGGACAGGGCTCACAC
AGTCGACAAAAGAAAACGTTTTTCTTGGGAGATGGGCAGAAGCTGAAGGACTGGCATGAC
AAGGAGGCCATCCGGAGGGACGCTCAGCGCGTAGGAAATGGAGAACAAGGAAGACCTTAC
CCCATGACCGATGCTGAGAGAGTGGATCAGGCATACCGAGAAAATGGATTTAACATCTAC
GTCAGTGATAAAATCTCCTTGAATCGCTCTCTCCCAGATATCCGGCACCCAAACTGCAAC
AGCAAGCGCTACCTGGAGACACTTCCCAACACAAGCATCATCATCCCCTTCCACAACGAG
GGCTGGTCCTCCCTCCTCCGCACCGTCCACAGTGTGCTCAATCGCTCGCCTCCAGAGCTG
GTCGCCGAGATTGTACTGGTCGACGACTTCAGTGATCGAGAGCACCTGAAGAAGCCTCTT
GAAGACTACATGGCCCTTTTCCCCAGTGTGAGGATTCTTCGAACCAAGAAACGGGAAGGG
CTGATAAGGACCCGAATGCTGGGGGCCTCAGTGGCAACTGGGGATGTCATCACATTCTTG
GATTCACACTGTGAAGCCAATGTCAACTGGCTTCCCCCCTTGCTTGACCGCATTGCTCGG
AACCGCAAGACCATTGTGTGCCCGATGATTGATGTAATTGACCATGACGACTTTCGGTAC
GAGACACAGGCAGGGGATGCCATGCGGGGAGCCTTTGACTGGGAGATGTACTACAAGCGG
ATCCCGATCCCTCCAGAACTGCAGAAAGCTGACCCCAGCGACCCATTTGAGTCTCCCGTG
ATGGCCGGTGGACTGTTCGCCGTGGATCGGAAGTGGTTCTGGGAACTCGGCGGGTATGAC
CCAGGCTTGGAGATCTGGGGAGGGGAGCAGTATGAAATCTCCTTCAAGGTGTGGATGTGT
GGGGGCCGCATGGAGGACATCCCCTGCTCCAGGGTGGGCCATATCTACAGGAAGTATGTG
CCCTACAAGGTCCCGGCCGGAGTCAGCCTGGCCCGGAACCTTAAGCGGGTGGCCGAAGTG
TGGATGGATGAGTACGCAGAGTACATTTACCAGCGCCGGCCTGAATACCGCCACCTCTCC
GCTGGGGATGTCGCAGTCCAGAAAAAGCTCCGCAGCTCCCTTAACTGCAAGAGTTTCAAG
TGGTTTATGACGAAGATAGCCTGGGACCTGCCCAAATTCTACCCACCCGTGGAGCCCCCG
GCTGCAGCTTGGGGGGAGATCCGAAATGTGGGCACAGGGCTGTGTGCAGACACAAAGCAC
GGGGCCTTGGGCTCCCCACTAAGGCTAGAGGGCTGCGTCCGAGGCCGTGGGGAGGCTGCC
TGGAACAACATGCAGGTATTCACCTTCACCTGGAGAGAGGACATCCGGCCTGGAGACCCC
CAGCACACCAAGAAGTTCTGCTTTGATGCCATTTCCCACACCAGCCCTGTCACGCTGTAC
GACTGCCACAGCATGAAGGGCAACCAGCTGTGGAAATACCGCAAAGACAAGACCCTGTAC
CACCCTGTCAGTGGCAGCTGCATGGACTGCAGTGAAAGTGACCATAGGATCTTCATGAAC
ACCTGCAACCCATCCTCTCTCACCCAGCAGTGGCTGTTTGAACACACCAACTCAACAGTC
TTGGAAAAATTCAATAGGAACTGAGCCCTCATGTCCCCTTGGCAGGCCCCCCAGGGTCTG
GCACTCACTGCAGACTTCCTCTTTCAAGGGAGGCAGGGCCCCTGTGGGCACTAGGTGTAA
AAGGTGCTGGCCAAATGGTTCAGGGTGAAGAGGGCTCTTGATTCAGGGGCTGGGGTCTGC
CTGGTCCTTGAGCCCCTGAGTTGTGGGGGTAGGGTGAAGAGCATATCCCACAAGAGGCCC
CACAGGGAGCAGAGACTGCTTTAATCCCTGCTGACATCACGGAAAAGCAACAGAGCCTTT
TCAACTTTGTCACTATGTCCCCTTGAACATTATGTGGGAGAACACCAAGGTAGCCTAGGC
CACCCAAAAGTGAGTCCTGCGAGGTTGCCCAGCCCTCAGATGGCTCTCCTACATGATGGT
GCTTTAGAAACAAAGGTAAAATTTGCCTGTTTGGGGCAGCTTTTAGTATCGATGCCACTC
ATCTGCAGCAGAAGAGAAAGAAGTCCTCTTGGGGCTTTTTAGTTTCTGCCGTCCTGGGGG
GAACATTGCAGTTACTGCACAGCTTCTGTTCTCTGTCACAACCCCAGGTGATTTGGTCCG
GTCAAAGGCCATACTTGGGGCCCTAAGAGTGTTCAGTATTGAATGCTGATCAGCTGCCAG
GTGAGGAGTCAGAAGAGGGAGCCCCCCTAGACATTTCTTTGCAGCTATGGACATGCGGGA
TATCTCCCCCTGCTCTCTGGGTATTTGAAATGTCAATTTTAGCACTCTCCAGGCACAAGG
ACAGCCCAGCACCAGCTTTACAGGGCAGTGTTTCAGATGGCCCTGAGCCCACGGAAAAGG
CCAGGTAGACCTCCAAACTAGAAATGCTGGCTGATTTGCCCTGATCCATGCTTCCATTTC
CCTGTCTCTCTTCCCCAGGCAATTACTGGCCTCAAAAGAGGAACAGAGGTGCTGCGAGGT
GCTCACCTCACAGAGTCTGGAGGCCTCCAGGATCAACTGTGGGCAAAGTGCCTGCCTCTG
ACCTCATCATGGTTCTAGTTCTCATACAGAACTCCAGAATTTTTAAAGAACTCTATAATT
GGATTGCAAACTAGGATGCTACATAGGATTCTGGTATTCCACATCCAATATGGATTTCTA
GAATGCTGTGATTAAAGGAGCCAGCCAGGTGTAATACAGTCAAGGCAGCCCCCAGCCTAG
AGACAATCTGTGAAATCCAAAGTTGGTGGTGTTGGGAAAGCAGGGGGACATGTGTCCCTC
AGCTCAGCAGAGGCTGTGGTACAACATGGTCCTTGGTGAAGACCTGCACCCCTGGAACCT
CCCACCATCATCACAACTGTAGTCTCATTTGCAGTGGAGAAAAGAACCCGACGTCCCACA
GCCAGATATACACCCAGCTCCATGCCAGCCCTTCATGTTTACCTTTTGCTTTGTTAATTA
CATGTCAGACTCCTAGAGGGCCTCCAGACTAATAGGAAGCATTTCTGTAACCAACCTGCC
ACCCACTGATTCAGAAATGGAAATCACATTCCACAATCTATGGCTTCCACCAGCTAGCCC
AGGAAATACTTGAAATCAGCATTCCAATTAGTGTTGAGTCTCTTGATTGTGTCATTTACC
AATTAAATAACTGAGACCTAAGTCTGGGAACAGAGCCACGAATCTGCCTTTGAGATGCTG
GCAGATCTCAAGGCCATCAATTATTGGGGGAGGGAGGGACAAACACTCCCAATCATCCAC
CAGTCAGACTGAATGTGTAGCTGGCGAGGAATTACTTCCACTTCTGGCCCAGCACAAGCC
CTGCTTTGGCCACCTGTCTGCAAGAGAGGCGGCCCCTGTGCTTGCAACGCTTACGTGTTG
ATCCCAGTGTCCTTTTCCAAATGAGTGCTGTAGCTTTAGAAGTGGCCCTCTATAGAAAGA
AGTCAAAAGATGAGGCCCCTTCTAGAATCTAGGATAACAAGAGTGTTGACAGTTTGAGGA
GTCGAATTGAGATTCATCATCAAAGAGCAATGCAGCGTCGTTAAAATAAAAACTGTGCCT
TTTAAAAAGAAAAATGCAAATATAGAGCAAATCCCTAAACTTGAACCATTTCCTAGTGCC
TTGCTAGACAAACATAAAGGGGCAGGGTTGTGGGGAGGGGAACGTTTTTGGTGGTGTGTG
CAGTTCCTACTGGATGAGTGTGTGTTTCTTAATGTCTCATTTCAAGCAGGAGATGTTGGG
TCTGGAGCAAGATCTGAGACTGAGATGTCCCCCAAGGGTGACAGGTCAGATTTATTTCAG
TCAGTGCAAGTCACACTCCAAACTAAAGGCTGGGCAGTGCGTTTAGTCTGTGGCCTAGAA
GACCTCATCAGCCCCCGAGAGGAGGCCTTGCATTACCTCACTGGGACCTGTTTGGGGGCC
ATCCCTGCGGTCCACCCTCTGAACCCCCAGCATGTTTGTCCTGTTTCTCACCATTGGGTT
AAGGGGTGCCGAGCACTAGCTAGACTTCCACATAGTCCCACCCCAAGTGGGCGGCAGTGT
TCCTGGCATGACCAGGATTCCTGTGAAAGCAGGAGCAGCAGCAAGCCGTCCCGGGCCTGC
CTTTCCCATCCTTTGGTTCTCCTTTCCAGTCTGGGTTCACACCCTGAAAAGGGATGGGTG
TGTCCTCTGAGCACTCTGGCATTTGTCATTGCTGAGCCCATATCAGTAGGTCCTGGGACT
TGACAAAGTATGTGGGAGGGGAAGGAAGGACAGAACTTGACTGGCTCCATTTCATGGACC
AACTGATCAATTGCCAGTACTAAGCCACTCATTGTTATGGCTTCCTTTTTGAAAACCACC
TGTCTCAAGGATTCAGGTTTCTGCTCACATCCCCAGCTGATGCTCAATAAAACTCAGCCA
GGAGCATATGGAGATGCTGACAGCCAGGTAATGGGTGAGACTGTGGGGTCCCTTTTCCTC
TAAAGCCTTTACTCTGAGGATAAGGTCACAAAGTAGGGTGTGACTTGAAAGTATCGTGAC
CATGTGGCCCACCAGCAGCCTTTCCAAAGGGGAACTCCAGAGACATTTCATAATGCAAAC
AGCACTGTTGCTTTAAGAACAAGGCCTTTGGAGGTGGCTAAACTTGCACGCACGTGTGTG
AAAAGCCATCCCATCTTCTGCCTCCAGTTGGAGCTTTCAGCTGTTAAAACAGTCAGAAAC
TATTGATTCTTCCCTTTAGGAAAAAATGCTCAGGCAGAACGGGGTACATCCACAGGAGGA
ATCGGACGAGAGGATGTGACATTCGGTCCAGGAGAGAAAGAGCAGTTTCTGTTAAAGATG
TAACAAATGGATTTCCAAAGTCTACATGACATTCACTTTTCAAACTTCCCACCAGTTGAA
TTTCTTTTTTTCCTTAAGAAACAGGTGATGTCTTGGAAAACAGCTCCTTATGTCTCTCTG
TGCATCTCCATTTTCCTAGTCTCTGGAGTCTCAAAAAGAGTGGCAAAGCACTTTACAGTA
GTAACTGAGGAATCAGAGTCTCTGCTTCAGCGATATCTAGTTTGTACAGTTGGGTGATCT
TTTGTAATTCCTAGGAGGTAATGCATTTTTAATGTTTTCTGAAGCTTTGTAAGTGTGAGA
GAGGGACAAGAAGTGCAGTTCTGTTCTGGAATTCCTTATTGCTTTCAACGGACACTCTTT
GTGAAAAATCCAAGTAATATTTTAGTTCAAACTTGATCTTGAGCCAAGGCCCACTGCCAC
CTCTGGGATGGGAGTCGGACCTACATACCAAGTGACAAGTTCACCTTAACATCTGCTTCC
AGAATGGCTTTGATTCAGCCGTGCCAGGCAACAGAACAGGGTCAGACTCCTGCTCTGTTA
TTGGCTTGAAGACTAGGATCCCAAAGGGGTTGGAGGCAGGGAATATTTGAAAATTCAGAC
TGGAATTCCAGGCCAAAAGCTCAAGACCACCAGCCTCTCCTCCTGCCTGGAAAAATAAGC
CTTTGTGAAAGACTGATTTACCATGTACAATTGTGATTGTGAACGTTGTTGAGTAAACCT
CCAGACTTTCTCTAAAAAAAAAAAAA

Protein Sequence

>55568 : length: 603
MRRKEKRLLQAVALVLAALVLLPNVGLWALYRERQPDGTPGGSGAAVAPAAGQGSHSRQK
KTFFLGDGQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDK
ISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEI
VLVDDFSDREHLKKPLEDYMALFPSVRILRTKKREGLIRTRMLGASVATGDVITFLDSHC
EANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIP
PELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRM
EDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDV
AVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALG
SPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHS
MKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKF
NRN