ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

55502

Name

HES6

Synonym

C-HAIRY1|HES-6|bHLHb41|bHLHc23;hes family bHLH transcription factor 6;HES6;hes family bHLH transcription factor 6

Definition

class B basic helix-loop-helix protein 41|hairy and enhancer of split 6|transcription cofactor HES-6

Position

2q37.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Notch-mediated HES/HEY network;PID Curated;200196

External Links

Links to cell senescence gene database

55502

Links to epithelial mesenchymal transition gene database

55502

Links to ovarian cancer gene database

55502

Links to endometrial cancer gene database

55502

Links to iHOP

55502

Sequence Information

Nucleotide Sequence

>55502 : length: 1470
GTCGGCCGCCCCGGGCCCGCGCGGCCAATCGGCGCATTGAGATGCAAATAAGCGGCTATA
AAAGGGGCGGGACCGCGGCGGGCCGGAAGCCGCGAGGAGCGCGGACGGCTGGGCTGCTGC
TGGGCGGCCGCGGGGCAGCGGAGGGCGCCGGCACTCCGGTCCCCGCCGCTCCCCGTCCCC
GCTGCTCCTAGCCCCTGCCGCGTCCCCGGCGGAGCGGGCATGGCGCCACCCGCGGCGCCT
GGCCGGGACCGTGTGGGCCGTGAGGATGAGGACGGCTGGGAGACGCGAGGGGACCGCAAG
GCCCGGAAGCCCCTGGTGGAGAAGAAGCGGCGCGCGCGGATCAACGAGAGCCTGCAGGAG
CTGCGGCTGCTGCTGGCGGGCGCCGAGGTGCAGGCCAAGCTGGAGAACGCCGAAGTGCTG
GAGCTGACGGTGCGGCGGGTCCAGGGTGTGCTGCGGGGCCGGGCGCGCGAGCGCGAGCAG
CTGCAGGCGGAAGCGAGCGAGCGCTTCGCTGCCGGCTACATCCAGTGCATGCACGAGGTG
CACACGTTCGTGTCCACGTGCCAGGCCATCGACGCTACCGTCGCTGCCGAGCTCCTGAAC
CATCTGCTCGAGTCCATGCCGCTGCGTGAGGGCAGCAGCTTCCAGGATCTGCTGGGGGAC
GCCCTGGCGGGGCCACCTAGAGCCCCTGGACGGAGTGGCTGGCCTGCGGGGGGCGCTCCG
GGATCCCCAATACCCAGCCCCCCGGGTCCTGGGGACGACCTGTGCTCCGACCTGGAGGAG
GCCCCTGAGGCTGAACTGAGTCAGGCTCCTGCTGAGGGGCCCGACTTGGTGCCCGCAGCC
CTGGGCAGCCTGACCACAGCCCAAATTGCCCGGAGTGTCTGGAGGCCTTGGTGACCAATG
CCAGCCAGAGTCCTGCGGGGGTGGGCCCGGCCCTCCCTGGATCTCCTCCCTCCTCCCAGG
GGTTCAGATGTGGTGGGGTAGGGCCCTGGAAGTCTCCCAGGTCTTCCCTCCCTCCTCTGA
TGGATGGCTTGCAGGGCAGCCCCTGGTAACCAGCCCAGTCAGGCCCCAGCCCCGTTTCTT
AAGAAACTTTTAGGGACCCTGCAGCTCTGGAGTGGGTGGAGGGAGGGAGCTACGGGCAGG
AGGAAGAATTTTGTAGAGCTGCCAGCGCTCTCCCAGGTTCACCCACCCAGGCTTCACCAG
CCCTGTGCGGGCTCTGGGGGCAGAGGTGGCAGAAATGGTGCTGGGCACTAGTGTTCCAGG
CAGCCCTGGGCTAAACAAAAGCTTGAACTTGCCACTTCAGCGGGGAGATGAGAGGCAGGT
GCACTGAGCTGCACTGCCCAGAGCTGTGATGCTCTGTACATCTTGTTTGTAGCACACTTG
AGTTTGTGTATTCCATTGACATCAAATGTGACAATTTTACTAAATAAAGAATTTTGGAGT
TAGTTACCCTTGAAAAAAAAAAAAAAAAAA

Protein Sequence

>55502 : length: 224
MAPPAAPGRDRVGREDEDGWETRGDRKARKPLVEKKRRARINESLQELRLLLAGAEVQAK
LENAEVLELTVRRVQGVLRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDAT
VAAELLNHLLESMPLREGSSFQDLLGDALAGPPRAPGRSGWPAGGAPGSPIPSPPGPGDD
LCSDLEEAPEAELSQAPAEGPDLVPAALGSLTTAQIARSVWRPW