ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

55359

Name

STYK1

Synonym

NOK|SuRTK106;serine/threonine/tyrosine kinase 1;STYK1;serine/threonine/tyrosine kinase 1

Definition

novel oncogene with kinase domain|protein PK-unique|tyrosine-protein kinase STYK1

Position

12p13.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

55359

Links to epithelial mesenchymal transition gene database

55359

Links to ovarian cancer gene database

55359

Links to endometrial cancer gene database

55359

Links to iHOP

55359

Sequence Information

Nucleotide Sequence

>55359 : length: 3022
GGAGTCACCGTGATACCTGACATCTAGCAATCACTAGAGTAGGAAATGAGTATAGATCAG
CAACAAGTCCAGCCTTTACAGTTGCAGCAGAGGTTTCCTGTGGCTCGAGTGTGGCGAGTC
CCGGAAACCTCGGAGCCCGCAGACTTCCCTTCGCGGGAGCCCGCCCGAACTCCATCCTTT
GCCGGCAGCCACGCCCCGCAGTGGGAAGGAGGGACTGAAAAGCATTTCCTTGAGGCTGGC
ACACCTTGCCCTACCCAACCCTGTCATTATTTCCCCTCCGACTGGGCCGGTGCCATCGGA
AACCGGAGTGACCAGAGGAGGGACACGCATCCAATTTCACTGGGCTGCAAGATATCAATA
AGCCTTGCCTCTTTAAACTACTTATGTACAAATAAAAGTGATGGTGAGAACCTGGCTCAG
GAAATGCAGTAGCAGGCCATATTGCATCCAAAGGAATTACTCACAGCTGTGCTGTGTGCA
TTCTCTGTGGGCCTAGCAGGGAAGGGGACAGCCCTGTGGCAATGGGCATGACACGGATGC
TCCTGGAATGCAGTCTCAGTGACAAGTTGTGTGTCATCCAGGAGAAGCAGTATGAAGTGA
TTATCGTCCCAACTTTGTTGGTTACTATCTTCCTCATCCTTCTTGGGGTCATCCTGTGGC
TTTTTATCAGAGAACAAAGAACTCAACAGCAGCGTTCTGGACCTCAAGGCATTGCCCCTG
TTCCTCCACCTAGGGACCTAAGCTGGGAAGCAGGACATGGAGGAAATGTGGCTTTGCCAC
TTAAGGAGACATCCGTGGAAAACTTTCTGGGAGCTACCACACCTGCCCTGGCTAAGCTGC
AGGTGCCGCGGGAGCAACTCTCTGAAGTTCTGGAGCAGATTTGCAGTGGTAGCTGTGGGC
CCATCTTTCGAGCCAATATGAACACTGGGGACCCTTCTAAGCCCAAGAGTGTTATTCTCA
AGGCTTTAAAAGAACCAGCTGGGCTCCATGAGGTACAAGATTTCTTAGGGCGAATCCAAT
TCCATCAATACCTGGGGAAACACAAAAACCTGGTGCAGCTGGAAGGCTGCTGCACTGAAA
AGCTGCCACTCTATATGGTGTTGGAGGATGTGGCCCAGGGGGACCTGCTCAGCTTTCTCT
GGACCTGTCGGCGGGATGTGATGACTATGGATGGTCTTCTCTATGATCTCACAGAAAAAC
AAGTATATCACATCGGAAAGCAGGTCCTTTTGGCGCTGGAATTCCTGCAGGAGAAGCATT
TGTTCCATGGGGATGTGGCAGCCAGGAATATTCTGATGCAAAGTGATCTCACTGCTAAGC
TCTGTGGATTAGGCCTGGCTTATGAAGTTTACACCCGAGGGGCCATCTCCTCTACTCAAA
CCATACCTCTCAAGTGGCTTGCCCCAGAACGGCTTCTCCTGAGACCTGCTAGCATCAGAG
CAGATGTCTGGTCTTTTGGGATCCTGCTCTATGAGATGGTGACTCTAGGAGCACCACCGT
ATCCTGAAGTCCCTCCTACCAGCATCCTAGAGCATCTCCAAAGAAGGAAAATCATGAAGA
GACCCAGTAGCTGCACACATACCATGTACAGTATCATGAAGTCCTGCTGGCGCTGGCGTG
AGGCTGACCGCCCCTCACCTAGAGAGCTGCGCTTGCGCCTAGAAGCTGCCATTAAAACTG
CAGATGACGAGGCTGTGTTACAAGTACCAGAGTTGGTGGTACCTGAACTGTATGCAGCTG
TGGCCGGCATCAGAGTGGAGAGCCTCTTCTACAACTATAGCATGCTTTGAAGAGTCTCGG
GCAAGAAACATTCATGCATGAGTATATGTTCTTGGAATCAATTCCTCTAAGAACAGAGAA
TGGTCTTTCCCAGGGACACAAAGGGAGAAATGGGACATGGATTCTTGATCTTCCTTTACA
CATTTCTCGGGAAATCTGAAATGATGCTGGATGGGACTCTACACATCCTGAGCTAAGACA
TACTGTCAGTCTCACTTCTGCTGTCCCAGTCCTAGAAATCCTGGGTAGAAGTGGTGGACC
TGTGCAAAGGAGGTTTTAGAACTCTGCAGTATTTGTTGGGGCATGGCACAAATAAGCTCA
TCCCTCCCGTCCGAGGCTAGTTTCCTCTGGAACCACATTTTTATCTAGATGAAAATTTGG
AATGAAATGAAGGAATAGAAATCCAATAAAAGAGTTGAAGGGAAAGAAAATTTAAGGTTC
TTCTTGCTCAGGATTACAGATATGGACCAACACCTCCTTCAAGAAAAGGTGGTAGGACAC
AAAGTTCTTCAGTCCTGAGCCCTACATGTGGGGTTGGAGGAGAACTATAACGGAAAAACC
TCTGAGTTTCACCTTAGGTATAGATAAAAGAAAGATGGTCCCCTTTTATCTGATTCTGAG
ACAGGTAAATTCTGTTTGTTACTACGTTTAATTAGAAGGTGGAGGAGTCATTTCATGATT
AAGAACATTCAACATGTATTGTTCATTAAGCTAGCTTCCTAGTTCCGATTAGACTAAGGA
GACTAAGCCTAGAGAGTCAATGTTAGAACAGTGAAAAGAATTCTGTGTGTGTGTGTGTGT
GTGTGCACAATAAATAGGAAATGTAGAAACCAAGCAAGAAGGCTTAGTAGCTCAGTCTTT
AACAAGGGCTAGAAAAGAATGTAATCTGATATGGAAGGATAGCAGCTTCTAATTTTCAAT
CATCTGTTGATATACTGTGAAACTTATTTTATTAAATTAATATTTATTAAATGGAAATAT
GCTTTTCTGGTTTATAACTACTAAAAATATCATAGGGAGGATAAAAGTAAATAAGTGAAA
GTTAATGCCAATAGAAAAATTCAAGAGATAATGTACAATGTCAGAAAAGGGATTCTTTAT
GTGTAAATGGGGATAATACCTATTTCACAAGGTTGTTCTGAGGATTGATACGTTTTGAGT
ATGTATTTGTACACTATCTGGCACATATGCGCTCAATAAACGTGTTTCTCCTTTTAAAAA
AAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>55359 : length: 422
MGMTRMLLECSLSDKLCVIQEKQYEVIIVPTLLVTIFLILLGVILWLFIREQRTQQQRSG
PQGIAPVPPPRDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQVPREQLSEVLEQI
CSGSCGPIFRANMNTGDPSKPKSVILKALKEPAGLHEVQDFLGRIQFHQYLGKHKNLVQL
EGCCTEKLPLYMVLEDVAQGDLLSFLWTCRRDVMTMDGLLYDLTEKQVYHIGKQVLLALE
FLQEKHLFHGDVAARNILMQSDLTAKLCGLGLAYEVYTRGAISSTQTIPLKWLAPERLLL
RPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKIMKRPSSCTHTMYSIMK
SCWRWREADRPSPRELRLRLEAAIKTADDEAVLQVPELVVPELYAAVAGIRVESLFYNYS
ML