ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

55353

Name

LAPTM4B

Synonym

LAPTM4beta|LC27;lysosomal protein transmembrane 4 beta;LAPTM4B;lysosomal protein transmembrane 4 beta

Definition

lysosomal associated protein transmembrane 4 beta|lysosomal-associated transmembrane protein 4B|lysosome-associated transmembrane protein 4-beta

Position

8q22.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Lysosome;KEGG PATHWAY;hsa04142

Disease

CANCER;GAD

Disease

stomach cancer;GAD

External Links

Links to cell senescence gene database

55353

Links to epithelial mesenchymal transition gene database

55353

Links to ovarian cancer gene database

55353

Links to endometrial cancer gene database

55353

Links to iHOP

55353

Sequence Information

Nucleotide Sequence

>55353 : length: 2242
GAATCTCGACCCTTGAATGGAGTTACACGAACGGCCAGATGAAAGAAGGAAGGCCCGGAC
CTCCACTCAGGGCCGACTAGGGGACTGGCGGAGGGTGCACGCTGATGGATTTACTCACCG
GGTGCTTGGAGCTCCAGCAGCTGGCTGGAGCCCGCGATGACGTCACGGACTCGGGTCACA
TGGCCAAGTCCGCCCCGCCCCCTCCCCGTCCCCGCCGCTGCAGCGGTCGCCTTCGGAGCG
AAGGGTACCGACCCGGCAGAAGCTCGGAGCTCTCGGGGTATCGAGGAGGCAGGCCCGCGG
GCGCACGGGCGAGCGGGCCGGGAGCCGGAGCGGCGGAGGAGCCGGCAGCAGCGGCGCGGC
GGGCTCCAGGCGAGGCGGTCGACGCTCCTGAAAACTTGCGCGCGCGCTCGCGCCACTGCG
CCCGGAGCGATGAAGATGGTCGCGCCCTGGACGCGGTTCTACTCCAACAGCTGCTGCTTG
TGCTGCCATGTCCGCACCGGCACCATCCTGCTCGGCGTCTGGTATCTGATCATCAATGCT
GTGGTACTGTTGATTTTATTGAGTGCCCTGGCTGATCCGGATCAGTATAACTTTTCAAGT
TCTGAACTGGGAGGTGACTTTGAGTTCATGGATGATGCCAACATGTGCATTGCCATTGCG
ATTTCTCTTCTCATGATCCTGATATGTGCTATGGCTACTTACGGAGCGTACAAGCAACGC
GCAGCCTGGATCATCCCATTCTTCTGTTACCAGATCTTTGACTTTGCCCTGAACATGTTG
GTTGCAATCACTGTGCTTATTTATCCAAACTCCATTCAGGAATACATACGGCAACTGCCT
CCTAATTTTCCCTACAGAGATGATGTCATGTCAGTGAATCCTACCTGTTTGGTCCTTATT
ATTCTTCTGTTTATTAGCATTATCTTGACTTTTAAGGGTTACTTGATTAGCTGTGTTTGG
AACTGCTACCGATACATCAATGGTAGGAACTCCTCTGATGTCCTGGTTTATGTTACCAGC
AATGACACTACGGTGCTGCTACCCCCGTATGATGATGCCACTGTGAATGGTGCTGCCAAG
GAGCCACCGCCACCTTACGTGTCTGCCTAAGCCTTCAAGTGGGCGGAGCTGAGGGCAGCA
GCTTGACTTTGCAGACATCTGAGCAATAGTTCTGTTATTTCACTTTTGCCATGAGCCTCT
CTGAGCTTGTTTGTTGCTGAAATGCTACTTTTTAAAATTTAGATGTTAGATTGAAAACTG
TAGTTTTCAACATATGCTTTGCTGGAACACTGTGATAGATTAACTGTAGAATTCTTCCTG
TACGATTGGGGATATAATGGGCTTCACTAACCTTCCCTAGGCATTGAAACTTCCCCCAAA
TCTGATGGACCTAGAAGTCTGCTTTTGTACCTGCTGGGCCCCAAAGTTGGGCATTTTTCT
CTCTGTTCCCTCTCTTTTGAAAATGTAAAATAAAACCAAAAATAGACAACTTTTTCTTCA
GCCATTCCAGCATAGAGAACAAAACCTTATGGAAACAGGAATGTCAATTGTGTAATCATT
GTTCTAATTAGGTAAATAGAAGTCCTTATGTATGTGTTACAAGAATTTCCCCCACAACAT
CCTTTATGACTGAAGTTCAATGACAGTTTGTGTTTGGTGGTAAAGGATTTTCTCCATGGC
CTGAATTAAGACCATTAGAAAGCACCAGGCCGTGGGAGCAGTGACCATCTGCTGACTGTT
CTTGTGGATCTTGTGTCCAGGGACATGGGGTGACATGCCTCGTATGTGTTAGAGGGTGGA
ATGGATGTGTTTGGCGCTGCATGGGATCTGGTGCCCCTCTTCTCCTGGATTCACATCCCC
ACCCAGGGCCCGCTTTTACTAAGTGTTCTGCCCTAGATTGGTTCAAGGAGGTCATCCAAC
TGACTTTATCAAGTGGAATTGGGATATATTTGATATACTTCTGCCTAACAACATGGAAAA
GGGTTTTCTTTTCCCTGCAAGCTACATCCTACTGCTTTGAACTTCCAAGTATGTCTAGTC
ACCTTTTAAAATGTAAACATTTTCAGAAAAATGAGGATTGCCTTCCTTGTATGCGCTTTT
TACCTTGACTACCTGAATTGCAAGGGATTTTTATATATTCATATGTTACAAAGTCAGCAA
CTCTCCTGTTGGTTCATTATTGAATGTGCTGTAAATTAAGTTGTTTGCAATTAAAACAAG
GTTTGCCCACATCCAAGAAAAA

Protein Sequence

>55353 : length: 317
MTSRTRVTWPSPPRPLPVPAAAAVAFGAKGTDPAEARSSRGIEEAGPRAHGRAGREPERR
RSRQQRRGGLQARRSTLLKTCARARATAPGAMKMVAPWTRFYSNSCCLCCHVRTGTILLG
VWYLIINAVVLLILLSALADPDQYNFSSSELGGDFEFMDDANMCIAIAISLLMILICAMA
TYGAYKQRAAWIIPFFCYQIFDFALNMLVAITVLIYPNSIQEYIRQLPPNFPYRDDVMSV
NPTCLVLIILLFISIILTFKGYLISCVWNCYRYINGRNSSDVLVYVTSNDTTVLLPPYDD
ATVNGAAKEPPPPYVSA