ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

55290

Name

BRF2

Synonym

BRFU|TFIIIB50;BRF2, RNA polymerase III transcription initiation factor 50 kDa subunit;BRF2;BRF2, RNA polymerase III transcription initiation factor 50 kDa subunit

Definition

B-related factor 2|BRF-2|BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like|RNA polymerase III transcription initiation factor BRFU|hBRFU|hTFIIIB50|transcription factor IIB- related factor, TFIIIB50|transcription factor IIIB 50

Position

8p11.23

Gene Type

protein-coding

Pathways and Diseases

Pathway

General transcription regulation;PANTHER;P00023

Pathway

Transcription regulation by bZIP transcription factor;PANTHER;P00055

Pathway

Transcription;Reactome;REACT:1788

External Links

Links to cell senescence gene database

55290

Links to epithelial mesenchymal transition gene database

55290

Links to ovarian cancer gene database

55290

Links to endometrial cancer gene database

55290

Links to iHOP

55290

Sequence Information

Nucleotide Sequence

>55290 : length: 2007
CCGTCGCGCTGGCCGGAAGACGGGGGTGCAACCCTTTGAAGTGTCCCCTCCTACTTCTTG
CTGCCTCACGGTTGCTGTTGCAGACCCAGGAGTCTCTGAAGGCTTCCGCGGCTTTGGGGC
CGGTTGTGAGATGCCAGGCAGAGGCCGCTGCCCGGACTGCGGCTCCACGGAGCTGGTGGA
AGACTCGCACTATTCGCAGAGCCAGCTGGTGTGCTCCGACTGCGGCTGCGTGGTCACCGA
GGGGGTCCTTACCACTACCTTCAGCGACGAGGGCAATCTCCGAGAGGTAACATATTCCCG
AAGCACAGGGGAAAACGAACAAGTTAGTCGCAGCCAGCAACGAGGTCTCCGGCGAGTGAG
AGACCTTTGTCGAGTTCTGCAGTTGCCACCAACATTTGAGGATACCGCGGTTGCCTACTA
CCAACAGGCATATCGGCACTCTGGCATCCGAGCGGCCAGGCTGCAAAAGAAGGAGGTGTT
GGTTGGGTGCTGCGTCTTAATCACCTGCCGACAGCATAACTGGCCCCTAACAATGGGGGC
CATCTGCACGCTGTTGTATGCAGATTTGGATGTGTTTTCTAGCACTTACATGCAGATAGT
GAAGCTCCTGGGACTGGATGTGCCATCTCTGTGCTTGGCAGAACTGGTGAAGACCTATTG
CAGCAGCTTCAAACTGTTCCAAGCTTCACCTTCTGTGCCAGCCAAATACGTGGAAGACAA
AGAGAAGATGCTGTCTCGAACAATGCAGTTGGTGGAGCTGGCAAATGAGACGTGGCTGGT
GACCGGGAGGCATCCCTTGCCCGTCATCACTGCTGCGACTTTCCTGGCTTGGCAGTCGCT
GCAGCCTGCAGATCGGCTTTCATGTTCCCTTGCCCGATTTTGTAAATTGGCAAATGTGGA
CCTGCCCTACCCGGCGTCCTCCCGCCTGCAGGAGCTGCTGGCTGTGCTGCTGCGGATGGC
TGAGCAGCTGGCCTGGTTACGAGTTCTGAGACTTGACAAACGGTCTGTGGTGAAGCACAT
CGGTGACCTTCTCCAGCACCGCCAGTCACTGGTCCGCTCTGCCTTTCGGGATGGGACAGC
AGAAGTGGAGACCCGAGAGAAGGAGCCACCGGGGTGGGGACAGGGGCAAGGAGAAGGGGA
GGTGGGAAATAATTCCTTAGGTTTACCCCAGGGGAAGCGGCCGGCCAGTCCTGCCCTTCT
CTTGCCACCCTGCATGTTGAAGTCCCCGAAGCGGATCTGCCCTGTACCCCCTGTCTCCAC
TGTCACTGGAGATGAGAACATTTCTGATAGTGAAATAGAACAGTATTTGCGTACCCCTCA
GGAAGTTAGGGACTTTCAGAGAGCCCAGGCTGCTAGACAGGCTGCCACGAGTGTCCCTAA
CCCTCCCTGATGGATATCCACTGGGAGCACTTCATCCTGTTCTGACAGCTTGATAACATT
CCTGTTATAACCAAGGATGGAAGTGTACACCAGTCCGTAGGTATTGCTTTTCTTGTTTGA
AGGAACCAAGAGGGGCTCTGCCATTAGTTGGACCCTGGGTCCTGGAGTAAAGTCAGGAGT
GCAGGGATGACTATAGGTAGGAGAGATTCCCATCCCTTGGTGTGGGAGAGCAAGTTGCCT
ATGTCCATGTTCTGTGAGATGGCTTTCCTCATAGATGGATGGGAAAATGTCAGGCTCTTT
GCTGCTGGTTTGAATTGGACACACTGCTGCGGCTCCTCCTGCAGGCCTGAGGGGGCTTCC
CTCTGCTTGTGGAGTGGTTGGCATTCCCAGCAGTATCAACCCTCAGAGGAGCGGGAACTG
GGGAATTCTGGCCCTACGTGCATTCACAGGCAATGATGGGTTTGTGTGTATGGTGTCATG
AGATCCTCTACCTCATAACAAAAGGACAGTGGGTAGACTAAGGCAGTAGCTCAAAGGGCT
TTGCAAAATTTTAATATATTAAAACAAGAGGCATCTGCTAGAAAACATTCTATTGTATAA
AACCCGAGTTCTTAAAAACAAAAAAAA

Protein Sequence

>55290 : length: 419
MPGRGRCPDCGSTELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTG
ENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRAARLQKKEVLVGC
CVLITCRQHNWPLTMGAICTLLYADLDVFSSTYMQIVKLLGLDVPSLCLAELVKTYCSSF
KLFQASPSVPAKYVEDKEKMLSRTMQLVELANETWLVTGRHPLPVITAATFLAWQSLQPA
DRLSCSLARFCKLANVDLPYPASSRLQELLAVLLRMAEQLAWLRVLRLDKRSVVKHIGDL
LQHRQSLVRSAFRDGTAEVETREKEPPGWGQGQGEGEVGNNSLGLPQGKRPASPALLLPP
CMLKSPKRICPVPPVSTVTGDENISDSEIEQYLRTPQEVRDFQRAQAARQAATSVPNPP