ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

55281

Name

TMEM140

Synonym

transmembrane protein 140;TMEM140;transmembrane protein 140

Definition

-

Position

7q33

Gene Type

protein-coding

External Links

Links to cell senescence gene database

55281

Links to epithelial mesenchymal transition gene database

55281

Links to ovarian cancer gene database

55281

Links to endometrial cancer gene database

55281

Links to iHOP

55281

Sequence Information

Nucleotide Sequence

>55281 : length: 2072
GAAACGAAAGTGAAATCAGCTGATAGTGACATCAGTCAGAACAAATGTACCAAAGTTCAG
AGAGCTGTTTACTAGGCACGACTGCGAAGGCAAGGGGGCACCAGCTCAGGACTGCATCTG
CCTGCCATTTCCCTTCCACTCCTCCTTTCTGGAGTCTGACATTAGAAAGCCAGCGAGAAG
GAAGATTCAAACAACCAACCCTGATTTCCTGCTTCTCCTTTTCATGAGTGTTCCTGTGGT
CTCTGCACCTCCTTTCTGTCCCCCGGCAGAGGGCAGTAGAGATGGCCGGCCCAAGGCCTC
GGTGGCGCGACCAGCTGCTGTTCATGAGCATCATAGTCCTCGTGATTGTGGTCATCTGCC
TGATGTTTTACGCTCTTCTCTGGGAGGCTGGCAACCTCACTGACCTGCCCAACCTGAGAA
TCGGCTTCTATAACTTCTGCCTGTGGAATGAGGACACCAGCACCCTACAGTGTCACCAGT
TCCCTGAGCTGGAAGCCCTGGGGGTGCCTCGGGTTGGCCTGGGCCTGGCCAGGCTTGGCG
TGTACGGGTCCCTGGTCCTCACCCTCTTTGCCCCCCAGCCTCTCCTCCTAGCCCAGTGCA
ACAGTGATGAGAGAGCGTGGCGGCTGGCAGTGGGCTTCCTGGCTGTGTCCTCTGTGCTGC
TGGCAGGCGGCCTGGGCCTCTTCCTCTCCTATGTGTGGAAGTGGGTCAGGCTCTCCCTCC
CGGGGCCTGGGTTTCTAGCTCTGGGCAGCGCCCAGGCCTTACTCATCCTCTTGCTTATAG
CCATGGCTGTGTTCCCTCTGAGGGCTGAGAGGGCTGAGAGCAAGCTTGAGAGCTGCTAAA
GGCTTACGTGATTGCAAGGGTTCAGTTCCAACCATGGTCAGAGGTGGCACATCTGCTCAG
CCATCTCATTTTACAGCTAACGCTGATCTCCAGCTCCAGCGATGGAACCCACTACAGAGG
AGGTGGGGCCCCTGTGTCAAAGAGGCCGAGGGGCAGCAAGGGCAGCCAGGGCACCTGTGA
CTTCTTAGTACAAGATTGTCTGTCCTTCAGGACTTCCAAGGCTCCCAAAGACTCCCTAAA
CCATGCAGCTCATTGTCACACCAATTCCTGCTTTAATTAATGGATCTGAGCAAATCTTCC
TCTAGCTTCAGGAGGGTGGGGAGGGAGTGATTGCTGTCATGGGGCCAGACTTCCAGGCTG
ATTTGCCAAATGCCAAAATGAAACCTAGCAAAGAACTTACGGCAACAAACGAGGACATTA
AAAGAGCGAGCACCTCAGTGTCTCTGGGGACATGGTTAAGGAGCTTCCACTCAGCCCACC
ATAGTGAGTGGGCCGCCATAAGCCATCACTGGAACTCCAACCCCAGAGGTCCAGGAGTGA
TCTCTGAGTGACTCAACAAAGACAGGACACATGGGGTACAAAGACAAGGCTTGACTGCTT
CAAAGCTTCCCTGGACCTGAAGCCAGACAGGGCAGAGGCGTCCGCTGACAAATCACTCCC
ATGATGAGACCCTGGAGGACTCCAAATCCTCGCTGTGAACAGGACTGGACGGCTGCACAC
AAACAAACGCTGCCACCCTCCACTTCCCAACCCAGAACTTGGAAAGACATTAGCACAACT
TACGCATTGGGGAATTGTGTGTATTTTCTAGCACTTGTGTATTGGAAAACCTGTATGGCA
GTGATTTATTCATATATTCCTGTCCAAAGCCACACTGAAAACAGAGGCAGAGACATGTAC
TCTGGTGTGATCTCTTGTCCTCAGTGTCTCTTCTGGGCTCCTGTCCCTCTTGCTTTATAG
CTAGCTGCCCGGGGACCAAGGTACAGGTGAAAGCAAGGTAGCAGCTTGCGGGAGGAGGCC
TGTCTGGCTTACCAGTCTATACACTGTGGCCTCAACCTCCCAGACAGGGCAGAGAACTGT
GGGCAGCTCGTTTGCTTTCTAGGCTGGCTGGAGAGGTGGGAGCTCATTGATAGACTCATG
ATGGAAACTATTTTTGAAACAGGCTTCCTCCTTCAGGAGAGATCATGCGGACTAAACTGT
AGCAATTCCAGTGCAAAAAAAAAAAAAAAAAA

Protein Sequence

>55281 : length: 185
MAGPRPRWRDQLLFMSIIVLVIVVICLMFYALLWEAGNLTDLPNLRIGFYNFCLWNEDTS
TLQCHQFPELEALGVPRVGLGLARLGVYGSLVLTLFAPQPLLLAQCNSDERAWRLAVGFL
AVSSVLLAGGLGLFLSYVWKWVRLSLPGPGFLALGSAQALLILLLIAMAVFPLRAERAES
KLESC