ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

55249

Name

YY1AP1

Synonym

HCCA1|HCCA2|YAP|YY1AP;YY1 associated protein 1;YY1AP1;YY1 associated protein 1

Definition

YY1-associated protein 1|hepatocellular carcinoma susceptibility protein|hepatocellular carcinoma-associated protein 2

Position

1q22

Gene Type

protein-coding

External Links

Links to cell senescence gene database

55249

Links to epithelial mesenchymal transition gene database

55249

Links to ovarian cancer gene database

55249

Links to endometrial cancer gene database

55249

Links to iHOP

55249

Sequence Information

Nucleotide Sequence

>55249 : length: 3091
ACGCGTGAGGGCCTGCGCTGGAGCCGGCTTGACAGGGTCTGAGGGGGAGTGGAGAACTGG
GCGAGGAGGTTCCCGTGGGTGAGCGCGTACGGGATGGCTGGCTCGCAGGACGGCCGAAGG
TGGTGGTTGGTGGGAGCAGCCAGCGACGAGCCCGTAGACACTCGTACGCGTGCGGGCTGA
CGTGCGCGCTACATGGCCGGAGTCGGGCGAAGCGGGGGACCGTGGGGAAGAACGCGAGGA
GGGAGGAGTGGGAGGTTGGGGGTGTCGCTAGGCGCCCTTAGCTCCCTCCCTCTGGAGGAG
CTGCCGCGGCCACTCTGCTGCCGCCGCTGCCGCCGCCATTTTGGGTTCGCTTTGCGAGGG
GAAACGATCCCAGTGTCGGTTGCGGGATCCGCCTCCTCTCAGTTTGCCCCTTTAGCCCTC
CACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCGGCTTACCCGCTGGCCGCCTCCT
GACAAGCGGGAGGGATCCGCGGTGGACCCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCC
TCTTCCTCACTTCCCTGTACTCTCATCGCTCTCGGCCTCCGACACGAAAAGGAAGCAAAT
GAGCTGATGGAAGATCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAA
GATGATGGCCCAGAAGAGGAGGAGCGTGTGGCTGAGCCTCAAGCTAACTTTAACACCCCT
CAAGCTCTACGGTTTGAGGAACTACTGGCCAACCTACTAAATGAACAACATCAGATAGCG
AAGGAACTATTTGAACAGCTGAAGATGAAGAAACCTTCAGCCAAACAGCAGAAGGAGGTA
GAGAAGGTTAAACCCCAGTGTAAGGAAGTTCATCAGACCCTGATTCTGGACCCAGCACAA
AGGAAGAGACTCCAGCAGCAGATGCAGCAGCATGTTCAGCTCTTGACACAAATCCACCTT
CTTGCCACCTGCAACCCCAATCTCAATCCGGAGGCCAGTAGCACCAGGATATGTCTTAAA
GAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTT
CAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGC
ACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCCAATGAATTT
CCCTGTTTGCCAAAGCAAGTGGCTTGGATCCTGGCCACAAGCAAGGTTTTCATGTATCCA
GAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCCTCTTCACC
AAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGGACTGAGTTTCTT
AACCCTCTAATCAGCAAGTACCTTCTAACCTGCAAGACTGCCCGCCAACTGACAGTGAGA
ATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAATTTTATAAGAAGACC
AAACAGCTGCCAGTCCTAGGAAAATGCTGTGAAGAGATCCAGCCACATCAGTGGAAGCCA
CCTATAGAGAGAGAAGAACACCGGCTCCCATTCTGGTTAAAGGCCAGTCTGCCATCCATC
CAGGAAGAACTGCGGCACATGGCTGATGGTGCTAGAGAGGTAGGAAATATGACTGGAACC
ACTGAGATCAACTCAGATCAAGGCCTAGAAAAAGACAACTCAGAGTTGGGGAGTGAAACT
CGGTACCCACTGCTATTGCCTAAGGGTGTAGTCCTGAAACTGAAGCCAGTTGCCGACCGT
TTCCCCAAGAAGGCTTGGAGACAGAAGCGTTCATCAGTCCTGAAACCCCTCCTTATCCAA
CCCAGCCCCTCTCTCCAGCCCAGCTTCAACCCTGGGAAAACACCAGCCCAATCAACTCAT
TCAGAAGCCCCTCCGAGCAAAATGGTGCTCCGGATTCCTCACCCAATACAGCCAGCCACT
GTTTTACAGACAGTTCCAGGTGTCCCTCCACTGGGGGTCAGTGGAGGTGAGAGTTTTGAG
TCTCCTGCAGCACTGCCTGCTATGCCCCCTGAGGCCAGGACAAGCTTCCCTCTGTCTGAG
TCCCAGACTTTGCTCTCTTCTGCCCCTGTGCCCAAGGTAATGATGCCCTCCCCTGCCTCT
TCCATGTTTCGAAAGCCATATGTGAGACGGAGACCCTCAAAAAGAAGGGGAGCCAGGGCC
TTTCGCTGTATCAAACCTGCCCCTGTTATCCACCCTGCATCTGTTATCTTCACTGTTCCT
GCTACCACTGTGAAGATTGTGAGCCTTGGCGGTGGCTGTAACATGATCCAGCCTGTCAAT
GCGGCTGTGGCCCAGAGTCCCCAGACTATTCCCATCGCCACCCTCTTGGTTAACCCTACT
TCCTTCCCCTGTCCATTGAACCAGCCCCTTGTGGCCTCCTCTGTCTCACCCTTAATTGTT
TCTGGCAATTCTGTGAATCTTCCTATACCATCCACCCCTGAAGATAAGGCCCACATGAAT
GTGGACATTGCTTGTGCTGTGGCTGATGGGGAAAATGCCTTTCAGGGCCTAGAACCCAAA
TTAGAGCCCCAGGAACTATCTCCTCTCTCTGCTACTGTTTTCCCCAAAGTGGAACATAGC
CCAGGGCCTCCACCAGTCGATAAACAGTGCCAAGAAGGATTGTCAGAGAACAGTGCCTAT
CGCTGGACCGTTGTGAAAACAGAGGAGGGAAGGCAAGCTCTGGAGCCGCTCCCTCAGGGC
ATCCAGGAGTCTCTAAACAACTCTTCCCCTGGGGATTTAGAGGAAGTTGTCAAGATGGAA
CCTGAAGATGCTACAGAGGAAATCAGTGGATTTCTTTGAGCTAGGAGAATAAGAGTCTGG
AGACTGGGAGCCTTCACTTCGGCCTCCGATTGGTGGCGCATAGGGTGTAACCAATAGGAA
ACCCCTAAAGGGTACTTAAACCCCAGATTTTGCAACTGGGGCTCTTGAGCAGCTTGCTTT
AGCCTGCTCCCACTCTGTGGAATATACTTTTGCTTCAATAAATCTGTGCTTTTATTGCTT
CATTGTTTCATTGAAAAAAAAAAAAAAAAAA

Protein Sequence

>55249 : length: 888
MAGVGRSGGPWGRTRGGRSGRLGVSLGALSSLPLEELPRPLCCRRCRRHFGFALRGETIP
VSVAGSASSQFAPLALHLSLLLSRISASRLTRWPPPDKREGSAVDPGKRRSLAATPSSSL
PCTLIALGLRHEKEANELMEDLFETFQDEMGFSNMEDDGPEEEERVAEPQANFNTPQALR
FEELLANLLNEQHQIAKELFEQLKMKKPSAKQQKEVEKVKPQCKEVHQTLILDPAQRKRL
QQQMQQHVQLLTQIHLLATCNPNLNPEASSTRICLKELGTFAQSSIALHHQYNPKFQTLF
QPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWILATSKVFMYPELLP
VCSLKAKNPQDKILFTKAEDNLLALGLKHFEGTEFLNPLISKYLLTCKTARQLTVRIKNL
NMNRAPDNIIKFYKKTKQLPVLGKCCEEIQPHQWKPPIEREEHRLPFWLKASLPSIQEEL
RHMADGAREVGNMTGTTEINSDQGLEKDNSELGSETRYPLLLPKGVVLKLKPVADRFPKK
AWRQKRSSVLKPLLIQPSPSLQPSFNPGKTPAQSTHSEAPPSKMVLRIPHPIQPATVLQT
VPGVPPLGVSGGESFESPAALPAMPPEARTSFPLSESQTLLSSAPVPKVMMPSPASSMFR
KPYVRRRPSKRRGARAFRCIKPAPVIHPASVIFTVPATTVKIVSLGGGCNMIQPVNAAVA
QSPQTIPIATLLVNPTSFPCPLNQPLVASSVSPLIVSGNSVNLPIPSTPEDKAHMNVDIA
CAVADGENAFQGLEPKLEPQELSPLSATVFPKVEHSPGPPPVDKQCQEGLSENSAYRWTV
VKTEEGRQALEPLPQGIQESLNNSSPGDLEEVVKMEPEDATEEISGFL