ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

55211

Name

DPPA4

Synonym

2410091M23Rik;developmental pluripotency associated 4;DPPA4;developmental pluripotency associated 4

Definition

developmental pluripotency-associated protein 4

Position

3q13.13

Gene Type

protein-coding

External Links

Links to cell senescence gene database

55211

Links to epithelial mesenchymal transition gene database

55211

Links to ovarian cancer gene database

55211

Links to endometrial cancer gene database

55211

Links to iHOP

55211

Sequence Information

Nucleotide Sequence

>55211 : length: 2823
AAGTGGGAGGAGACTTTGCAAATAGCAATCTTGGGGCAGGGGCCATTTTGGAAGCATGTT
GCGAGGCTCCGCTTCTTCTACAAGTATGGAGAAGGCAAAAGGCAAGGAGTGGACCTCCAC
AGAGAAGTCGAGGGAAGAGGATCAGCAGGCTTCTAATCAACCAAATTCAATTGCTTTGCC
AGGAACATCAGCAAAGAGAACCAAAGAAAAAATGTCTATCAAAGGCAGTAAAGTGCTCTG
CCCTAAGAAAAAGGCAGAGCACACTGACAACCCCAGACCTCAGAAGAAGATACCAATCCC
TCCATTACCTTCTAAACTGCCACCTGTTAATCTGATTCACCGGGACATTCTGCGGGCCTG
GTGCCAACAATTGAAGCTGAGCTCCAAAGGCCAGAAATTGGATGCATATAAGCGCCTGTG
TGCCTTTGCCTACCCAAATCAAAAGGATTTTCCTAGCACAGCAAAAGAGGCCAAAATCCG
GAAATCATTGCAAAAAAAATTAAAGGTGGAAAAGGGGGAAACGTCCCTGCAAAGTTCTGA
GACACATCCTCCTGAAGTGGCTCTTCCTCCTGTGGGGGAGCCGCCTGCCCTGGAAAATTC
CACTGCTCTCCTTGAGGGAGTTAATACAGTTGTGGTGACAACTTCTGCCCCAGAGGCTTT
GCTGGCCTCCTGGGCGAGAATTTCAGCCAGGGCGAGGACACCAGAGGCAGTGGAATCTCC
ACAAGAGGCCTCTGGTGTCAGGTGGTGTGTGGTCCATGGGAAAAGTCTCCCTGCAGACAC
AGATGGTTGGGTTCACCTGCAGTTTCATGCTGGTCAAGCCTGGGTTCCAGAAAAGCAAGA
AGGGAGAGTGAGTGCACTCTTCTTGCTTCCTGCCTCCAATTTTCCACCCCCGCACCTTGA
AGACAATATGTTGTGCCCCAAATGTGTTCACAGGAACAAGGTCTTAATAAAAAGCCTCCA
ATGGGAATAGAATATCAGGAAAAAGGCCACATCTATGGTAATTAATGGCAGAAAAGCTGG
AGAGTTGGATTCTGCGGTGCTGCTGACAGGTGAACTCTGGTCCTCTGCACCTGTTTATGG
GCCATGCAGACTGGTGGGGTGGCAGATGTTAGCCTAAGACCCCTAGCAGTGCCTGTTGCT
TTGTGAGTGGAGATAGAGACTCTTACATTTAAAAATGGAAAAACATTTCACAAATTACCA
TAAATTGTAGTTAATATGTAGAAAAACTCATTCATACTACTTTTCTAAAATAGACATGAC
TTCAGCAGCAGCTTTTTTTTGTTGTATTTTGAGACAGTGTCTCACTGTTGCCCAGGCTGG
AGTGCAGTGGTGCAATCTCAGTTCAGTGCAATCTCCGCCTCCTGGGTTCAAATGATTCTC
CTGCCTCAGCCTCCTGAGTAGCTAGGTACAGGCACCTGCCACCACACCCAGCTAATTTTT
TGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCCAGGTTGGTCTCAAACTCCTGGA
CTCAAGTGATCACCCTCCTCAGCCTCCCAAAATGCTGGGACTATGGGCATGAGCCCCTGC
GCCTGACCTTCAACAGCTCTTTTAAGTGAGTTCTTCAGCTAAGCATTGTGATGGACTTGA
GTAAAATGGTAGTTGGCTCTTGTGCTCAATTTTCTCTTCCTCTGAACACTGACTACTTTA
GGAGCTGCTTCATTCCAATTGCAATTTCATAAAACGTAAAGTATTTTAAGGCAAAGAAAG
GCTGTTAATTCCCTCCCTCCCCCAAACACATGATTTTTAATATTCTAAACAATATTTTTC
AAAGTTCTCTTAATAACCTGAGATTTCTATGGTTTGACTCCAGGATCAAAACACAAGGGA
CTTTGTATTATTTCACTTATAATTGTTTTGTATATTTCTGGAGTTTAAAATGTTTAAGGT
TGCTTCCCGCTCATAAATACATAATATATTGAATTTAAAATGTGTTTATTAACCGATTCT
CCATAAATAAAAATAAGATGTGTATGTAAAATAATTCATCTGTTGTATTTAGAGAACCAT
ATTCATTGCATGCAAATTTTATTGTTAGTGTTCTTAACTCAAGTAGGAGTAAACCAAAAA
GTGTGATTTTTCTTTTGTATGACTCGTTTGTTCTTTATTAGTTGGTGGTATGGGTTGGAT
CATTTGTTTTTAAAACTACTTAGGTATGATTCACATACAAAAAGCTGCACATATTTAATG
TATCCTATTGTGTAATTAATTTTTAATTTTTTTGTGTACTTCCTAAACTTATAGTCCTGC
GAGTCTGGGAACAGATCTGTTTTTCACTTATCCTGATTTAATGACAGTTTCCAACATTGT
TTTGTTATTACAAGTAGGGGATCTTTTTTTTTGCCCGTTTAATGAAGATACTAAAAATAA
TGCACTGGAAGGAGTGGAAGAGTTGGAAAATTTGTAACCATCATAATACAGGTGTAATAG
GTTTGGGAAAGAATCCTCAAAAATGTTAAAGCAAGGGAGGAAAGTTTGTTGAGAAGCAAG
ATGTTCTTCTCTCCTGCCCGCCCCCGCCGTTGGTTGTTGGTGGTCAGAATTATTGTGTAA
TAAATAATAGACATTTTTTCTTATACTATGTGTATTGTTCCTTTTGTTTCCTTTTTAAAC
TTCTCCCCTGCTTTATTTGGATGGGTCAAGTTTCTGTTCTGTTTCCTTCCTTTCTATTAA
TTTGGAAATGTCCTTGGCTTTACGATTCTGCTTGTAGATACTTCCCCTGCTTCTAACACA
TTTCAATAAACTTAAATTTCTCTATATACAAAATAAATTAATAATTGGAGTCTACCAAAA
AAA

Protein Sequence

>55211 : length: 304
MLRGSASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTKEKMSIKGSKV
LCPKKKAEHTDNPRPQKKIPIPPLPSKLPPVNLIHRDILRAWCQQLKLSSKGQKLDAYKR
LCAFAYPNQKDFPSTAKEAKIRKSLQKKLKVEKGETSLQSSETHPPEVALPPVGEPPALE
NSTALLEGVNTVVVTTSAPEALLASWARISARARTPEAVESPQEASGVRWCVVHGKSLPA
DTDGWVHLQFHAGQAWVPEKQEGRVSALFLLPASNFPPPHLEDNMLCPKCVHRNKVLIKS
LQWE