ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5518

Name

PPP2R1A

Synonym

PP2A-Aalpha|PP2AAALPHA|PR65A;protein phosphatase 2, regulatory subunit A, alpha;PPP2R1A;protein phosphatase 2, regulatory subunit A, alpha

Definition

PP2A subunit A isoform PR65-alpha|PP2A subunit A isoform R1-alpha|medium tumor antigen-associated 61 KDA protein|protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform|serine/threonine protein phosphatase 2A, 65 kDa regulatory su

Position

19q13.41

Gene Type

protein-coding

Pathways and Diseases

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

DNA Replication;Reactome;REACT:383

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Opioid Signalling;Reactome;REACT:15295

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Integration of energy metabolism;Reactome;REACT:1505

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

Loss of proteins required for interphase microtubule organization from the centrosome;PID Reactome;500383

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Pathway

Signaling by Wnt;Reactome;REACT:11045

Pathway

Long-term depression;KEGG PATHWAY;hsa04730

Pathway

Oocyte meiosis;KEGG PATHWAY;hsa04114

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

Hepatitis C;KEGG PATHWAY;hsa05160

Pathway

Loss of Nlp from mitotic centrosomes;PID Reactome;500384

Pathway

Metabolism of carbohydrates;Reactome;REACT:474

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

PLK1 signaling events;PID Curated;200087

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

External Links

Links to cell senescence gene database

5518

Links to epithelial mesenchymal transition gene database

5518

Links to ovarian cancer gene database

5518

Links to endometrial cancer gene database

5518

Links to iHOP

5518

Sequence Information

Nucleotide Sequence

>5518 : length: 2519
AATCTTGGTCGCTAGGACACGGCTAACTTCCGCTTTCTTCCCCCTCTCCTAGGCTCAAAC
TAGTCAAATCTTGTTCACTCGACCAATGGCAAATCGGAAGTGGGCGGGACTTCACAAGTC
CGGACCAAAGAAACGCGAGCTTAGCCCTGGGTAGCGCGGCCAATGGCCGTGGAGCAGCCC
CTGTAAACTGGCTCGGGCGCCCCCACGCCCGCCCTTCCTTCTTCTCCCAGCATTGCCCCC
CCCACGTTTCAGCACAGCGCTGGCCGCAGTCTGACAGGAAAGGGACGGAGCCAAGATGGC
GGCGGCCGACGGCGACGACTCGCTGTACCCCATCGCGGTGCTCATAGACGAACTCCGCAA
TGAGGACGTTCAGCTTCGCCTCAACAGCATCAAGAAGCTGTCCACCATCGCCTTGGCCCT
TGGGGTTGAAAGGACCCGAAGTGAGCTTCTGCCTTTCCTTACAGATACCATCTATGATGA
AGATGAGGTCCTCCTGGCCCTGGCAGAACAGCTGGGAACCTTCACTACCCTGGTGGGAGG
CCCAGAGTACGTGCACTGCCTGCTGCCACCGCTGGAGTCGCTGGCCACAGTGGAGGAGAC
AGTGGTGCGGGACAAGGCAGTGGAGTCCTTACGGGCCATCTCACACGAGCACTCGCCCTC
TGACCTGGAGGCGCACTTTGTGCCGCTAGTGAAGCGGCTGGCGGGCGGCGACTGGTTCAC
CTCCCGCACCTCGGCCTGCGGCCTCTTCTCCGTCTGCTACCCCCGAGTGTCCAGTGCTGT
GAAGGCGGAACTTCGACAGTACTTCCGGAACCTGTGCTCAGATGACACCCCCATGGTGCG
GCGGGCCGCAGCCTCCAAGCTGGGGGAGTTTGCCAAGGTGCTGGAGCTGGACAACGTCAA
GAGTGAGATCATCCCCATGTTCTCCAACCTGGCCTCTGACGAGCAGGACTCGGTGCGGCT
GCTGGCGGTGGAGGCGTGCGTGAACATCGCCCAGCTTCTGCCCCAGGAGGATCTGGAGGC
CCTGGTGATGCCCACTCTGCGCCAGGCCGCTGAAGACAAGTCCTGGCGCGTCCGCTACAT
GGTGGCTGACAAGTTCACAGAGCTCCAGAAAGCAGTGGGGCCTGAGATCACCAAGACAGA
CCTGGTCCCTGCCTTCCAGAACCTGATGAAAGACTGTGAGGCCGAGGTGAGGGCCGCAGC
CTCCCACAAGGTCAAAGAGTTCTGTGAAAACCTCTCAGCTGACTGTCGGGAGAATGTGAT
CATGTCCCAGATCTTGCCCTGCATCAAGGAGCTGGTGTCCGATGCCAACCAACATGTCAA
GTCTGCCCTGGCCTCAGTCATCATGGGTCTCTCTCCCATCTTGGGCAAAGACAACACCAT
CGAGCACCTCTTGCCCCTCTTCCTGGCTCAGCTGAAGGATGAGTGCCCTGAGGTACGGCT
GAACATCATCTCTAACCTGGACTGTGTGAACGAGGTGATTGGCATCCGGCAGCTGTCCCA
GTCCCTGCTCCCTGCCATTGTGGAGCTGGCTGAGGACGCCAAGTGGCGGGTGCGGCTGGC
CATCATTGAGTACATGCCCCTCCTGGCTGGACAGCTGGGAGTGGAGTTCTTTGATGAGAA
ACTTAACTCCTTGTGCATGGCCTGGCTTGTGGATCATGTATATGCCATCCGCGAGGCAGC
CACCAGCAACCTGAAGAAGCTAGTGGAAAAGTTTGGGAAGGAGTGGGCCCATGCCACAAT
CATCCCCAAGGTCTTGGCCATGTCCGGAGACCCCAACTACCTGCACCGCATGACTACGCT
CTTCTGCATCAATGTGCTGTCTGAGGTCTGTGGGCAGGACATCACCACCAAGCACATGCT
ACCCACGGTTCTGCGCATGGCTGGGGACCCGGTTGCCAATGTCCGCTTCAATGTGGCCAA
GTCTCTGCAGAAGATAGGGCCCATCCTGGACAACAGCACCTTGCAGAGTGAAGTCAAGCC
CATCCTAGAGAAGCTGACCCAGGACCAGGATGTGGACGTCAAATACTTTGCCCAGGAGGC
TCTGACTGTTCTGTCTCTCGCCTGATGCTGGAAGAGGAGCAAACACTGGCCTCTGGTGTC
CACCCTCCAACCCCCACAAGTCCCTCTTTGGGGAGACACTGGGGGGCCTTTGGCTGTCAC
TCCCTGTGCATGGTCTGACCCCAGGCCCCTTCCCCCAGCACGGTTCCTCCTCTCCCCAGC
CTGGGAAGATGTCTCACTGTCCACCTCCCAACGGGCTAGGGGAGCACGGGGTTGGACAGG
ACAGTGACCTTGGGAGGAAGGGGCTACTCCGCCCACGTCAGGGAGAGATGTGAGCATCCC
GGGTCACTGGATCCTGCTGCTGTAATGGGAACCCCTCCCCCATTTACTTCTCCACCTCCC
GTCCTCCCCATCATTGGTTTTTTTTTGTGTGTCAACTGTGCCGTTTTTATTTTATTCCTT
TTATTTTCCCCCTTTTCACAGAGAAATAAAGGTCTAGAAGTAGTTGGTCAAAAAAAAAA

Protein Sequence

>5518 : length: 589
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA