ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5514

Name

PPP1R10

Synonym

CAT53|FB19|PNUTS|PP1R10|R111|p99;protein phosphatase 1, regulatory subunit 10;PPP1R10;protein phosphatase 1, regulatory subunit 10

Definition

HLA-C associated transcript 53|MHC class I region proline-rich protein CAT53|PP1-binding protein of 114 kDa|phosphatase 1 nuclear targeting subunit|protein phosphatase 1, regulatory (inhibitor) subunit 10|serine/threonine-protein phosphatase 1 regulatory

Position

6p21.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

5514

Links to epithelial mesenchymal transition gene database

5514

Links to ovarian cancer gene database

5514

Links to endometrial cancer gene database

5514

Links to iHOP

5514

Sequence Information

Nucleotide Sequence

>5514 : length: 4604
AGCACGTTTGGGCGCGTTGGGCGGCGTCCGGGTATAAAAGACTCCACCCGAGCGGGCGGC
CGCCATTCTGGGGTTCGTTTAGAGGTTTGAATTTTCTCGGAGAAAGACAGGCCGGCCACG
AGGAAAACAGAAACAAGCCGCAGCAACATCTAAGCCCTTGAAAGGATCCTGAGAGAGGGG
GGAAAGGGAAAACAGCAGCCACCAGCCCAACCACTTGTGTCTTCTGCCCCTTCCCACCTA
TCTTGCCCACCCCACCAGCCCACGCTGCTTGGGACTTGAAATCTGTGGCCGAAGGACCGT
CACTACATAACTTCAAAAATAATCAACCACCCTCCCTTCCCAAACCACCCAAATTCACTC
ATCCAGCGTTTACTTTTTTGAATCCACTCAGAACTTTTTTCTGCGACCCCCCTCCCTAAA
TGGAGTTGGGTGGGGGGGAAATGAATACTGAGTTGGCCTTTATTTTTTAAAAGACTTTTT
GATCCAATGAGGCCCCCTAAATAATTGAGTTTTGGGTCCTGGTTGGTTGTTTTATTTTTT
TTCCTCCAAAATTTTACCCCCTCCCCCCTGAGCCCGAGGTGCTGACGTCGCAAAAAAATT
GGATAAAACCACCATCATGGGTTCGGGTCCCATAGACCCCAAAGAACTTCTCAAGGGCCT
GGACAGCTTCCTTAACCGAGATGGGGAAGTCAAAAGTGTGGATGGGATTTCCAAGATCTT
CAGTTTGATGAAGGAAGCACGAAAGATGGTGAGTCGATGCACTTACTTGAACATTCTCCT
GCAGACCCGTTCACCAGAAATATTGGTCAAATTTATTGACGTTGGCGGCTACAAACTTCT
TAACAATTGGCTGACGTATTCAAAGACAACCAACAACATTCCCCTCCTCCAGCAAATTCT
ACTGACCCTGCAGCATCTACCGCTCACTGTAGACCATCTCAAGCAGAACAACACAGCTAA
ACTGGTGAAGCAGCTGAGCAAGTCAAGTGAGGATGAAGAGCTCCGGAAATTGGCCTCAGT
CCTTGTCAGCGACTGGATGGCTGTCATCCGCTCTCAGAGCAGTACCCAGCCTGCTGAGAA
AGATAAGAAGAAACGTAAAGATGAAGGAAAAAGTCGAACTACCCTTCCTGAGCGACCTTT
GACAGAGGTGAAGGCTGAGACCCGGGCTGAGGAGGCCCCAGAGAAGAAGAGGGAGAAGCC
CAAGTCTCTTCGCACCACAGCACCCAGTCATGCCAAGTTCCGTTCCACTGGACTAGAGCT
GGAGACACCATCCTTGGTGCCTGTGAAGAAGAATGCCAGCACAGTGGTGGTTTCTGACAA
GTACAACCTTAAACCCATCCCCCTCAAACGTCAGAGCAACGTAGCTGCTCCAGGAGATGC
CACTCCCCCTGCAGAGAAGAAATACAAGCCACTCAACACAACACCTAATGCCACCAAAGA
GATCAAAGTGAAGATCATCCCGCCACAGCCTATGGAGGGCCTGGGCTTTCTGGATGCTCT
TAATTCAGCCCCTGTTCCAGGCATCAAAATTAAGAAGAAAAAAAAAGTACTGTCACCTAC
GGCTGCCAAGCCAAGCCCCTTTGAAGGGAAAACGAGCACAGAACCAAGCACAGCCAAACC
TTCTTCCCCAGAACCAGCACCACCTTCTGAGGCAATGGACGCAGACCGTCCAGGCACCCC
GGTTCCCCCTGTTGAAGTCCCGGAGCTCATGGATACAGCCTCTTTGGAGCCAGGAGCTCT
GGATGCCAAGCCAGTGGAGAGTCCTGGAGATCCTAACCAACTGACCCGGAAAGGCAGGAA
GAGGAAAAGTGTGACATGGCCTGAGGAAGGCAAACTGAGAGAATATTTCTATTTTGAATT
GGATGAAACTGAACGAGTAAATGTGAATAAGATCAAGGACTTTGGTGAGGCGGCTAAGCG
AGAGATACTGTCAGACCGACATGCATTTGAGACAGCGCGGCGTCTGAGCCATGATAACAT
GGAGGAGAAGGTGCCCTGGGTGTGCCCCCGGCCCCTGGTTCTGCCCTCACCTCTTGTCAC
CCCTGGAAGCAATAGTCAGGAGCGATATATCCAGGCTGAGCGGGAGAAGGGAATCCTTCA
GGAGCTCTTCCTGAACAAGGAGAGTCCTCATGAGCCTGATCCTGAGCCCTACGAGCCCAT
ACCCCCTAAACTCATCCCCCTAGATGAGGAGTGTTCCATGGATGAGACTCCGTATGTTGA
GACTCTGGAACCTGGGGGGTCAGGTGGCTCACCTGATGGGGCAGGAGGCTCCAAGTTGCC
TCCAGTTCTGGCCAATCTTATGGGAAGCATGGGTGCTGGAAAGGGCCCCCAAGGCCCTGG
AGGAGGAGGCATTAATGTCCAAGAGATCCTCACCTCCATCATGGGTAGCCCAAACAGTCA
TCCTTCAGAGGAACTACTGAAACAACCAGACTATTCGGACAAGATCAAGCAGATGCTGGT
GCCACATGGACTCCTAGGCCCTGGCCCAATAGCCAATGGTTTCCCACCAGGGGGTCCTGG
GGGCCCCAAGGGCATGCAGCACTTTCCCCCTGGACCTGGGGGACCTATGCCAGGTCCCCA
TGGAGGCCCTGGTGGGCCAGTGGGTCCACGTCTTCTGGGTCCTCCACCCCCTCCCCGGGG
AGGTGATCCCTTCTGGGATGGCCCGGGCGACCCTATGCGGGGTGGCCCAATGCGGGGGGG
TCCAGGACCAGGTCCTGGACCATACCATAGAGGCCGAGGTGGCCGAGGAGGAAACGAACC
TCCTCCTCCTCCTCCTCCATTCCGAGGCGCCAGAGGAGGTCGCTCTGGAGGAGGACCCCC
AAATGGACGAGGGGGCCCTGGTGGGGGCATGGTTGGAGGTGGTGGGCATCGTCCTCACGA
AGGCCCTGGTGGGGGCATGGGCAACAGCAGTGGACATCGTCCCCACGAAGGCCCTGGCGG
TGGCATGGGAAGTGGGCATCGCCCCCATGAAGGCCCTGGTGGTAGCATGGGTGGGGGTGG
AGGACATCGTCCCCACGAAGGCCCTGGCGGTGGCATCAGTGGTGGCAGTGGCCATCGTCC
CCATGAAGGCCCTGGCGGAGGAATGGGTGCCGGTGGTGGACATCGCCCCCACGAAGGCCC
TGGCGGAAGCATGGGTGGAAGTGGTGGACATCGTCCCCATGAAGGCCCTGGACACGGGGG
GCCCCATGGCCACCGGCCTCATGATGTCCCTGGTCACCGAGGCCATGACCATCGAGGGCC
GCCACCTCATGAGCACCGTGGCCATGATGGTCCTGGCCACGGGGGAGGGGGCCACCGAGG
GCACGATGGAGGCCACAGCCATGGAGGAGACATGTCAAACCGCCCTGTCTGCCGACATTT
CATGATGAAGGGCAACTGCCGCTATGAGAACAACTGTGCCTTCTACCACCCGGGTGTCAA
TGGGCCCCCCCTGCCCTAGGGACCATTTGCCTGCCCTGTTCACACAACCCCTGTGGACTG
CAGCCTCGCTCTTTCCACCCTGTTATGGCTTCTGTGAGGCCCATTTTCCCTTTTCCCCAG
CTGATGAGGAGCCGGCCCCCTCAGTTCCCACTTGCTTGGGTTCCTGGGGGTTTTCTGATC
ACTGGTGCGCATTGATGTACATATTTTCCTCCAGTCTGGGGAGGAGAGAGACTGGAAACG
TTCCTGGACTGCTGAAGAGGAGACCCAGTTGGCTTCACTTTTTGAGAAGATTCGCCCTGT
ACCCCAAACCCCTTTCCAGTATTACCCTTAATGCTTGAGAACCTAAAGCTGGTTATCCTG
GCGAACACCCCTACCCTTCTATTGCGGGTCCCCACATGCACACAGAACTCTGACACAGGA
TCAGCTGCACTTAAGAAATCATCCCAGCTAAGTTCATTATTCCTCATGGGGTGGGGAGAT
GCTGAAAGGGGTATTGTATATCCCACTGCACTGAGAGGGCTCAATCAGCTGGATTTGAGT
TCTGGAACACACATCATCCCCACCCCTCCCCCAGCGTGGGCTCACCATTCTTAGTCCTTT
CTCAAGTGGGACCTTCAACTTTCTGTGAACACCCAGTCTGCGTCCTGGGTCTGCTAGGTT
CGATGATGGCGAACTCGTATCTGCATCCGGTGCAAGTTTTAGCTGGCAGAGGTGAGACCG
GTGGTGCTGGTCTGCCTTTGCCAACTATAGCCAGTCTGGAGACTTGATAAAATACTTCAG
TGAGACCAGCTTCTCATCAACTTGGGCCCGGCGTGCTGGGCCTGAAAGTCACACTACATG
CACTGCCTTTGGGAGTCAGCTCACTCCCTGCTCCCACCTGGAACCTTGCCAGCGTGAAGG
AGGCTTCCAGGTACTTCACCCTGTCAACCACCTCTGAATCCCCACCAGGCGCCTTCCTGG
GTGGATTCAACAAGATGATTTTGCCCTTTCCCAGTTCTCTCCTTCACTTTGGCATCAGTT
GTTTTCTATGAAAACAGTGGATTGGTTGGGTTTTGTGCAGGGTCTTGGGTTAGAGCCAAA
ATGGATTTGAGGATGAGTATTTTTTTTTTTGGTTTTGTATATTTTGTACATTAATAATAA
ACAGTGGAAAGAGAAGCAGCTTATTTAAAAAAAAAAAAAAAAAA

Protein Sequence

>5514 : length: 940
MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSP
EILVKFIDVGGYKLLNNWLTYSKTTNNIPLLQQILLTLQHLPLTVDHLKQNNTAKLVKQL
SKSSEDEELRKLASVLVSDWMAVIRSQSSTQPAEKDKKKRKDEGKSRTTLPERPLTEVKA
ETRAEEAPEKKREKPKSLRTTAPSHAKFRSTGLELETPSLVPVKKNASTVVVSDKYNLKP
IPLKRQSNVAAPGDATPPAEKKYKPLNTTPNATKEIKVKIIPPQPMEGLGFLDALNSAPV
PGIKIKKKKKVLSPTAAKPSPFEGKTSTEPSTAKPSSPEPAPPSEAMDADRPGTPVPPVE
VPELMDTASLEPGALDAKPVESPGDPNQLTRKGRKRKSVTWPEEGKLREYFYFELDETER
VNVNKIKDFGEAAKREILSDRHAFETARRLSHDNMEEKVPWVCPRPLVLPSPLVTPGSNS
QERYIQAEREKGILQELFLNKESPHEPDPEPYEPIPPKLIPLDEECSMDETPYVETLEPG
GSGGSPDGAGGSKLPPVLANLMGSMGAGKGPQGPGGGGINVQEILTSIMGSPNSHPSEEL
LKQPDYSDKIKQMLVPHGLLGPGPIANGFPPGGPGGPKGMQHFPPGPGGPMPGPHGGPGG
PVGPRLLGPPPPPRGGDPFWDGPGDPMRGGPMRGGPGPGPGPYHRGRGGRGGNEPPPPPP
PFRGARGGRSGGGPPNGRGGPGGGMVGGGGHRPHEGPGGGMGNSSGHRPHEGPGGGMGSG
HRPHEGPGGSMGGGGGHRPHEGPGGGISGGSGHRPHEGPGGGMGAGGGHRPHEGPGGSMG
GSGGHRPHEGPGHGGPHGHRPHDVPGHRGHDHRGPPPHEHRGHDGPGHGGGGHRGHDGGH
SHGGDMSNRPVCRHFMMKGNCRYENNCAFYHPGVNGPPLP