ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

55122

Name

AKIRIN2

Synonym

C6orf166|FBI1|dJ486L4.2;akirin 2;AKIRIN2;akirin 2

Definition

akirin-2|fourteen-three-three beta interactant 1

Position

6q15

Gene Type

protein-coding

External Links

Links to cell senescence gene database

55122

Links to epithelial mesenchymal transition gene database

55122

Links to ovarian cancer gene database

55122

Links to endometrial cancer gene database

55122

Links to iHOP

55122

Sequence Information

Nucleotide Sequence

>55122 : length: 1948
TATTGACGCCATATTGGGGCCGGCGGCGGGTGGGAGAGTTCTACGAGGGAGGGGAAGCGG
TTGGACGTGTTCGCTTGGGTTCCTGCTGCGGCAGCTACCTCGCAATCTCTCTGCATCGAT
CGCCGCTCGCAAGCTACTGACCGTACTCGGGCGTATTAGGAGCCGCGTTCCAGCCTCACA
CCCCACGGTGCTGTTTTCGACTTCAGAAAGGATCTAGTCTCAGCACAGAAGCGCCTCAGG
CGCGGCGCAAAGCTCGAGCGGACGGCGGGGGCGGCCGGAGCCTCTCTCGGGGGAGCCGCG
CCTGAGGAGGCGGAAGAACCCCCCTGACGCGACTGGCGTGTGCTTCTGCCCGCCACCGCC
CCTCCCGCTCTCACCCGGGCCGTCCCTGGCCACTGCCCCTGCCGCGGAGGCAGCGGCGGC
AGCGGCTCTCCTTTCCACAGCCGGCGCTCCGCGACCCGCTTGGCTCCTGAGCCCGTCGGG
TAGGCTCTCCTCGAGTTCCCGCTCTTCACCCCTTCCCTCACCCTCTTCTTTCGTCACCCG
TCCCCGACCCCACCCGAGCCCGGCGCCTCAGCTGCCCCCGGCCATGGCGTGCGGAGCCAC
TCTGAAAAGGACTCTGGATTTCGACCCGCTGTTGAGCCCGGCGTCCCCGAAGCGCAGGCG
ATGTGCGCCATTGTCGGCGCCCACCTCGGCCGCTGCCTCCCCGTTGTCGGCGGCCGCGGC
CACCGCCGCCTCCTTCTCCGCTGCGGCCGCCTCGCCGCAGAAGTATCTCCGAATGGAGCC
ATCCCCCTTCGGCGACGTCTCCTCCCGCCTCACCACAGAACAAATTCTGTACAACATAAA
ACAAGAGTATAAACGAATGCAGAAGAGAAGACATTTAGAAACGAGTTTCCAACAGACAGA
TCCGTGTTGTACTTCTGATGCACAGCCACATGCATTTCTCCTCAGTGGACCAGCTTCACC
AGGGACTTCATCTGCAGCATCCTCACCATTAAAAAAAGAACAGCCCTTATTTACTCTACG
GCAGGTTGGGATGATCTGTGAACGTTTGTTGAAAGAACGTGAAGAGAAAGTTCGAGAAGA
ATATGAAGAAATATTGAACACAAAACTTGCAGAACAATATGATGCGTTTGTGAAGTTTAC
GCATGATCAAATAATGCGACGATATGGAGAACAGCCTGCTAGCTATGTTTCATGAATCAC
GTATCCTGCATTTGTGGGCTGCCTTGTTCCTTGTTGAGTTGTTGCAAGAGGTCCCAATTA
TGACATGCAGCAATGCCAATACCCCTTCTGTGAATACAGGTTATTTCAAGCTTTCGTCAG
TGGCAACCACTCTTAGGCAGCAGCAACTGGTTTTGGAAATTTCCCTGATGTCAGTACCAC
CTGGATGTGGACCTTTGCTACCTGTATTAATACCAGTGGCCTCATTTTGCTGTATCATTA
CAATTTGGCTTCTTATATTAATGTTTGAAAAGGATTAAAGCTGGTATTCTAGAACATGCC
CTTCACTGGTTGTGTAAATAAAACTGTAGAATGACACTTCAGATGAAGTTAGTGTGATTT
TAATTGTGCACTACAACCGAGCTGTAACCAGTTACTAATTTTAGAATGTAATCCCAGGAC
AATATTAAGCAAATAGCCTGCAGTGCTTCCTGTGAAATAGTGAAGGAGGAGGGCATTTCT
GTATTCCAGGACTTCTTGGGGTTTCAGAATGGGTTTGTATGATTTTTTTTTTTTTTGTAG
TTTTATTTATTCTATCAGTCTTTTTAACAAATGTTTATTGCTGCATTTTTTTTTTTCCAG
TGTATCATTGTTTTACTGCCCTTGTAGTACTGGAATTTAGTTGGAAGAATAAAACATTTA
CTTCTATTTTGCTTGTTTCTTAATGTACAGATGGGGTTAGTATTTGAATAAAGTTGGTGT
TTTAAAACGTAAAAAAAAAAAAAAAAAA

Protein Sequence

>55122 : length: 203
MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAAASPLSAAAATAASFSAAAASPQK
YLRMEPSPFGDVSSRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLL
SGPASPGTSSAASSPLKKEQPLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYD
AFVKFTHDQIMRRYGEQPASYVS