ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

54971

Name

BANP

Synonym

BEND1|SMAR1|SMARBP1;BTG3 associated nuclear protein;BANP;BTG3 associated nuclear protein

Definition

BEN domain-containing protein 1|protein BANP|scaffold/matrix-associated region-1-binding protein

Position

16q24

Gene Type

protein-coding

External Links

Links to cell senescence gene database

54971

Links to epithelial mesenchymal transition gene database

54971

Links to ovarian cancer gene database

54971

Links to endometrial cancer gene database

54971

Links to iHOP

54971

Sequence Information

Nucleotide Sequence

>54971 : length: 5526
AGAGCGGCGGCTTCTCTCGCGAGGACGGACGCCATTATCGCATCTCCCCGACAAACACCA
CGAGAATTCCGCAGCCCACACGGTGACCAAAAGCCAGCCCCACTGTGAGTTGAACTCTTT
CGTGTTGACCGGCCACTCTCCGTGCTCTGGATGATGTCGGAACACGACCTGGCCGATGTG
GTTCAGATTGCAGTGGAAGACCTGAGCCCTGACCACCCAGGTACAGAGCTGTGGGACATT
GTTTTGGAGAATCATGTAGTGACAGATGAAGACGAACCTGCTTTGAAACGCCAGCGACTA
GAAATCAATTGCCAGGATCCATCTATAAAGTCATTCCTGTATTCCATCAACCAGACAATC
TGCTTGCGGTTGGATAGCATTGAAGCCAAATTGCAAGCCCTGGAGGCTACTTGTAAATCC
TTAGAAGAAAAGCTGGATCTGGTCACGAACAAGCAGCACAGCCCCATCCAGGTCCCCATG
GTGGCCGGCTCCCCTCTCGGGGCAACCCAGACGTGCAACAAAGTGCGATGCGTCGTCCCC
CAGACTACAGTAATACTCAACAATGATCGGCAGAACGCCATTGTAGCCAAGATGGAAGAC
CCCTTGAGCAACAGGGCACCGGATTCCCTGGAAAATGTCATTAGCAACGCTGTGCCTGGG
CGTCGGCAGAACACCATTGTGGTGAAGGTGCCGGGCCAAGAAGACAGCCACCACGAGGAC
GGGGAGAGCGGCTCGGAGGCCAGCGACTCTGTGTCCAGCTGTGGGCAGGCGGGCAGTCAG
AGCATCGGGAGCAACGTCACGCTCATCACCCTGAACTCGGAAGAGGACTACCCCAATGGC
ACCTGGCTGGGCGACGAGAACAACCCCGAGATGCGGGTACGCTGCGCCATCATCCCCTCC
GACATGCTGCACATCAGCACCAACTGCCGCACGGCCGAGAAGATGGCGCTCACGCTGCTG
GACTACCTCTTCCACCGCGAGGTGCAGGCTGTGTCCAACCTCTCGGGGCAGGGCAAGCAC
GGGAAGAAGCAGCTGGACCCGCTCACCATCTACGGCATCCGGTTTCTTAGGATTTCTATC
CACGGCTCGCTCACGCCTCTGCTTGGACTCTGCATCCAAGCCGGTGACCCCGGATCTGAG
GGCTTTTCTAAAGAATGCTGTCTAAGGCCGTGCCACCCTGAACACACCCGATCTCGTCTG
ATCTAAAGAATGCTGCTGTGGATGGCCGATCCCCATGAGACCTCCTAGCAGTTACGGAAA
GACTGGATTCATTTGCACAAGGGTGCCTCAGGTTCCTGTGGCCGCGGGGACAAAGCTCAC
AGCCTGGCTGGCTTAGAACACAGGCTTGTGTTCTCGTGCAGGTTTGGAGGCCAGATGCCT
GGGATGAAGGTGTGGGCAGGGCCACGCTGCCTGAGAAGGCCCTTTCCCTCTCCCAGCTTC
TGGTGGTGGCCGCATCCCTCCAGTCTCTGGCCGCATCCCCCTCGGCTGTCTTCCCCCCAT
GTCTCCCTCTGTGTCCCTCTCCTTATGAGGACAGTCACTGGATTTGGAGCTCCCTCTCCT
GCAGGATGACCTCATTACAACCTAATGAATCACATCTGCAGAGACCCTAGTTCCCAGTCA
GGTCACATTCTGGGGTCCTGGACCAGGACGTGAGTTTTGTGGGGACACTGTTCAGCCCAG
GACACAGGACACGGGTGGTCAGGTGCTGTCTCTTCTCCAGGTTCTCTGTGAGGTGAAATG
GTGAGGCTGCCCTATATGTGTCCTTAAGGCAGAATGTGGACTCCATGCAGGGGTGGGTGT
TTGTCTGTGTATCTTGGGACATTGAGCGCCTCACGGTGACTGAGAGCTGGGAGGAAGGTG
TGGTCAGTGTGGGCTTCAGGCAGAAAAGTGAGCAGAGCCTCCTTCTCAGCAGGTCACCCA
GAAGCTGTGACCTGGAGGTGGTCCTGCAGGTGGCTGTGAGGGGCTCTCTGGCTAACAGAC
TGAGGACAGGTGTCTCTCCATCATTTTTTCTCATAAAGGAGTGAGTCAGCAGGCTTGAAG
AAGGTGGCCGGCTTGGCCTGGAGGCTGGACGTTTGAGGCAGCGCTGTCACGTCGAGTCTG
TAATTTGAAGAAATCAGTTGTTGGCACTCGGTTTTGTGGTGCCTTCCCTTGCACATGAGA
GTGTGTTAGCAGGTGGGGCTCTTCATTCCTTTGTGACTGATAAAGCCCCATGCCACCCAC
CAAGGCACAAGATGACAAGCCCTCCTGGCTCTCTCATCTCGCTTCCCACAGTGCCTCTCA
TGGCCCCACAGATGGAGAGCTGGGAATCGGCTTATGATTTGAACCACCAGAGTCAGTAAC
GGGGGTTCTGGAAAGTGGGAAGGCAGCTAACGGTGTAGTGGAGACTCTTTAGCTCTTTGG
GGACTGCAGAACAGCTCGCCAGGAAAATAGAGGCGTGCACTGTGGCAGGGATGCTGCCTG
GCTGAGCCTGGAAGGCAATCCCGTCCCGGCCTTGAGGGGCCTCGGTTGGTGTAGTGTGGG
GATATGGCTGGGGAAAGCAGGGACTGAGGCCAGACAGGGTGTTCTGCTCCCAGGTGACGC
CACGCTGTGGGGATCCCGTGAGCCTCAGCAGCCGGATGCCGAGCACTTCTGTTCTCCTTG
TGTCCTGGGCGCTGCTGCAGGGGAGACTTCTGCCTCGATTGAAGTCCGACTAGGCCTCCC
AGAGCAGGGGCTGCAGGTGCCTTGGGCTGAGGGAGCTCAGGACAGCAGAGTCACGTGTGC
GGGGCTGTGCGTGTTCTTCCCGTCTCCCCGAGCACCTCTCATGGGTTCTCAGGATCCAGT
GAGGGCCGCTGCTTCTTCACCTGGTGGGCCCAGGAAGCTTGCACTTTAAGGCCGGTGCTC
ACTCCTAACTAGTAATTGGACTTGGACACATCACTTCTCCTTTTTCTGGCTTTTGCCTCA
AAACCAAAGTGATGAGAGTAGTGACATTCCTACTTCATGAGGCTTTTAAAAAAAAATGTC
TGTCAAATAACATGAGATCAAATGCTTAAAGTGGAAAATGGCAGTTAAATTCAAGGTGAT
CTTTTGATCCCATCATGATAGGATTTTTCCCGCTCCCTGTTAAGTGCGGCTGCTCAGTGC
TGTCAGAAAAGGTAAAGGAATCCGAGCCCTGAGGGCTGCCCAGACGTGGGCGCTTGCCCC
AGCTGCTGTCCAGTAGCATCTGCGGGCGGCGCCTGCACCCGTAAGTGCATGTTCAGATCC
TCGCCCTCCTCACCCACTGCACTCTGCGGGCAGCACTTGGGCGGCTGGTCCGTTCTCTGG
ATCTCCTTTGTGGCCGGCAGGGGGCATTCGCCCAGGCTGGGGCCTGGAGCGCAGACGGAA
GGAATTAGATAATTTGATGTCTGAGGACAATGGAAACTCGGTGGCGGGTAACCAGATGAA
TATATATTTTTTATTTAATAAGTGTGAGTCAGGGTTTGAACTGGCAACTTGATTTTTACA
AAGTTGAATTTAAATGTGAATGTTTTCACCCATTTCTCTTACCTATACACCTGGGTGTTT
TAGATTTATCTTCTTTCCTGTTACTAACCCGTTTTTAAATTTTGTATGGACTCATTCATC
CTTCAAAGTCTATGGAATTTTTCTCCTGGAGTGTGAAGGTGGGAGGGTCACAGGAGGGCG
GTTCTGAGGATGTTTCTTTTTATCGACTCGTGCTCCAAAGATGTTTTCCTGCTGGTGGGA
TGGCTGTTTCTTTCTTGCCCTCCCGGTGGCAGCAGCTGGGCTGCTTTGTATCTAAAATCA
GTAGCTGGGCTCTCATGAAACTATTGAAGTGCAGTTTGAAAGCTGGGTTTTCCGGTAACT
ATGGTGCAACCTCTGGCAGCAGCTGGGCTCTCCTGTAAGGATTTCCTAGTGATTTTAATG
GTTGGGTTCCCCCATGACCACAGCCAGCGGCTGGGTTCCTCTGTGAGTCACTAAAGTTGC
TCAGCCTGGGGCTTCCTGAGGCGCCCGAGTCACCCAGCCAAGATTCGAGGGTGACTTGGA
GTATTTTAGAGATGACCCGAAAATTGGAAGCCAAAGGGCGGCTGCTTCCTGTATGGCTTC
TTTATGCATGAGGATGAAAATGTGCTGCCGAAACCACTTTAGGGTGTTCTTCCCTCTCAT
CCTACAAATCCCACCGTCCTGACTGGTTTCTTTTTGTCTGCAGCACAGACAGGTTGGTTG
TGATTATACAGAGATTCTAAACGTGTCTCAAGTATCTACTGATAAGAAAGTCAAGAGGCA
TGTTTCCAAAACCCGAGGGACTTTTGATACCTAATCGAGTACTTAAAAAAACCCAAACAC
TTCTTCCTCTGTTTTAATTATTTCCACCATTTTAGTCTCAATGGGAACAGATTTTTAGGG
TTTGGGCAGTAGAGTCCGAACTTGAGGCTCTTGGTAGTTGAAACGGGACACTTTTCAGCT
TAATCTTTTTATTACTACAATTTTGGATTCCATCCATGTATTTTCCTGTAAATTAGTGAA
GTTGCATGAGCCAGCTAGAGAGGCCACTGCATTGAAGAGCCCTTCCCATCATGCCCACAT
TCGTCATCGCTACAGGGATGGGGTCCTGTGGCCTAGTGGGAAGTGGCCGGGCGTGCAGTG
GGGCGCTGGCTCCCTCCTGTCACCTGCTCCGCCGTGGCCTTCGGATCCTCAGTTTTCTCC
CTGTTGAATACAGGGCATCTCTGGATGCTGCTCAGGGCGTGCTGAGAGCTCTCCGTAGCG
CAGGTGGTAGAGAACTGGGGGTCCCAGGACAGTTCTCTGCGTGTGCACGGTGAGCCCCAG
GAAGACGATGCACCTGGCTTTGGCCCCACAGTGAGAGTAGGTTGTGCCCACTCGGCTTGT
GGTATAGGGACTCCAGGGATGAGGACACAGGCCCTGCCCGTAAGGAGTTTGTACTCTAGT
TGAGAAGGCACGATAGAGAGGCGTCGGGAATGACATAAGCAAGCCCCGGACCTGAGCAGC
GATGGGAGGGTGTCTTGCAGTCCGTTGTCATCACTATTTACACAGGAGCAGCCACTGTGC
GCCAGAATGTTCTGGGTGCCTGACCCCCATGGGTGGACACAACAAAGGCCCCTGTGTTTA
TGAGGGGGACAGAGTAACAGTGCATACATGAATTCTCCAAACTGTGTTTGCGAGGGGAAC
AGAATAACAATACATGCGTGAATTCTCCAAACTGTGTTTACCAGGGGAACAGAGTAACAA
TACATACATGAATTCTCCAAACTGTGTTTGTGAGGGGGACAGAGTAACAATACATAACTT
GAATTCTCCAAACTGTGTTTATGAGGGGGACAGAGTAACAAAAATACATACTTCAATTCT
CCAAACCGTGTTTACCAGGGGAACAGAGTAACAATACATACATGAATTCTCCAAACTGTG
TTTGCGAGGGGAACAGTAACAATACACACCTGAATTTTCGAAACTGTGTTTGTGAGGGGG
ACAGAGTAACAATACACACATGAATTCTCCAAATGCCGGAAGGTGGTCAGTGCTCTGACA
AAACAA

Protein Sequence

>54971 : length: 536
MMSEHDLADVVQIAVEDLSPDHPGTELWDIVLENHVVTDEDEPALKRQRLEINCQDPSIK
SFLYSINQTICLRLDSIEAKLQALEATCKSLEEKLDLVTNKQHSPIQVPMVAGSPLGATQ
TCNKVRCVVPQTTVILNNDRQNAIVAKMEDPLSNRAPDSLENVISNAVPGRRQNTIVVKV
PGQEDSHHEDGESGSEASDSVSSCGQAGSQSIGSNVTLITLNSEEDYPNGTWLGDENNPE
MRVRCAIIPSDMLHISTNCRTAEKMALTLLDYLFHREVQAVSNLSGQGKHGKKQLDPLTI
YGIRCHLFYKFGITESDWYRIKQSIDSKCRTAWRRKQRGQSLAVKSFSRRTPNSSSYCPS
EPMMSTPPPASELPQPQPQPQALHYALANAQQVQIHQIGEDGQVQVIPQGHLHIAQVPQG
EQVQITQDSEGNLQIHHVGQDGQLLEATRIPCLLAPSVFKASSGQVLQGAQLIAVASSDP
AAAGVDGSPLQGSDIQVQYVQLAPVSDHTAGAQTAEALQPTLQPEMQLEHGAIQIQ