ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

54904

Name

WHSC1L1

Synonym

NSD3|pp14328;Wolf-Hirschhorn syndrome candidate 1-like 1;WHSC1L1;Wolf-Hirschhorn syndrome candidate 1-like 1

Definition

WHSC1-like 1 isoform 9 with methyltransferase activity to lysine|histone-lysine N-methyltransferase NSD3|nuclear SET domain-containing protein 3|protein whistle

Position

8p11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Lysine degradation;KEGG PATHWAY;hsa00310

Disease

Leukemia, acute myeloid;OMIM

External Links

Links to cell senescence gene database

54904

Links to epithelial mesenchymal transition gene database

54904

Links to ovarian cancer gene database

54904

Links to endometrial cancer gene database

54904

Links to iHOP

54904

Sequence Information

Nucleotide Sequence

>54904 : length: 10883
GCATTTCCCGGCAGGCGCCGCGGCCCGCGGCCAATGAGGGGCTGAGGATTTGGCGGCGGC
GGCGCCCCGAGAGTCGGGGTGGGGGGGCTTTGTGCGCGGCGGCGGCGGGAGAGGCGGCGG
CGGCGGCCAGCACGGAGGCGGAGGCCGAGGGGGCTGTGCACAGGTCGCCGCGGAGAGGCG
TGCGAATTCCGAGCCGAGCGCCGAGGACCGTGCTACCCAGGCCGGGCTGCCAGCCGCAGG
CTCCTCTCTGGCAGCAGCGGCGGCGCGGCGACCCCCGTCCCTCGGCCTCCCCTTCCCATC
CCACCTCCCGAGCCTTCCTCTTCCCGCAGCACGCCCGGCCCGGCCCGGCCGTGGCCCTCC
TCAGTGCCGGCCGCCATGGCAGAGGCGTCCGGCGCGGGGAAAATCTAGCCCGGGGATTTC
ATGCGGCCTAGCTCGGTTCCGCCTCCTCCTCGCGCGGCCCCAGCGGCTGCCCGCACCCCA
GCCCCACTCCGGGCCTCCGTGTCTCTCCTGTGATCGCACTGACACGGCCGGGGGGTTAGA
ATGGAACAAACTGAAGGCCCGATGAGAGAAAGGGAAAGTTAAGGATGCTGGAGCAGAACA
ATGGATTTCTCTTTCTCTTTCATGCAAGGGATCATGGGAAACACAATTCAGCAACCACCT
CAACTCATTGACTCCGCCAACATCCGTCAGGAGGATGCCTTTGATAACAACAGTGACATT
GCTGAAGATGGTGGCCAGACACCATATGAAGCTACTTTGCAGCAAGGCTTTCAGTACCCA
GCTACAACAGAAGATCTTCCTCCACTCACAAATGGGTATCCATCATCAATCAGTGTGTAT
GAAACTCAAACCAAATACCAGTCATATAATCAGTATCCTAATGGGTCAGCCAATGGCTTT
GGTGCAGTTAGAAACTTTAGCCCCACTGACTATTATCATTCAGAAATTCCAAACACAAGA
CCACATGAAATTCTGGAAAAACCTTCCCCTCCACAGCCACCACCTCCTCCTTCGGTACCA
CAAACTGTGATTCCAAAGAAGACTGGCTCACCTGAAATTAAACTAAAAATAACCAAAACT
ATCCAGAATGGCAGGGAATTGTTTGAGTCTTCCCTTTGTGGAGACCTTTTAAATGAAGTA
CAGGCAAGTGAGCACACGAAATCAAAGCATGAAAGCAGAAAAGAAAAGAGGAAAAAAAGC
AACAAGCATGACTCATCAAGATCTGAAGAGCGCAAGTCACACAAAATCCCCAAATTAGAA
CCAGAGGAACAAAATAGACCAAATGAGAGGGTTGACACTGTATCAGAAAAACCAAGGGAA
GAACCAGTACTAAAAGAGGAAGCCCCAGTTCAGCCAATACTATCTTCTGTTCCAACAACG
GAAGTGTCCACTGGTGTTAAGTTTCAGGTTGGCGATCTTGTGTGGTCCAAGGTGGGAACC
TATCCTTGGTGGCCTTGTATGGTTTCAAGTGATCCCCAGCTTGAGGTTCATACTAAAATT
AACACAAGAGGTGCCCGAGAATATCATGTCCAGTTTTTTAGCAACCAGCCAGAGAGGGCG
TGGGTTCATGAAAAACGGGTACGAGAGTATAAAGGTCATAAACAGTATGAAGAATTACTG
GCTGAGGCAACCAAACAAGCCAGCAATCACTCTGAGAAACAAAAGATTCGGAAACCCCGA
CCTCAGAGAGAACGTGCTCAGTGGGATATTGGCATTGCCCATGCAGAGAAAGCATTGAAA
ATGACTCGAGAAGAAAGAATAGAACAGTATACTTTTATTTACATTGATAAACAGCCTGAA
GAGGCTTTATCCCAAGCAAAAAAGAGTGTTGCCTCCAAAACCGAAGTTAAAAAAACCCGA
CGACCAAGATCTGTGCTGAATACTCAGCCAGAACAGACCAATGCAGGGGAGGTGGCCTCC
TCACTCTCAAGTACTGAAATTCGGAGACATAGCCAGAGGCGGCACACAAGTGCGGAAGAG
GAAGAGCCACCGCCTGTTAAAATAGCCTGGAAAACTGCGGCAGCAAGGAAATCCTTACCA
GCTTCCATTACGATGCACAAAGGGAGCCTGGATTTGCAGAAGTGTAACATGTCTCCAGTT
GTGAAAATTGAACAAGTGTTTGCTCTTCAGAATGCTACAGGGGATGGGAAATTTATCGAT
CAATTTGTTTATTCAACAAAGGGAATTGGTAACAAAACAGAAATAAGTGTCAGGGGGCAA
GACAGGCTTATAATTTCTACACCAAACCAGAGAAATGAAAAGCCAACGCAGAGTGTATCA
TCTCCTGAAGCAACATCTGGTTCTACAGGCTCAGTAGAAAAGAAGCAACAGAGAAGATCA
ATTAGAACTCGTTCTGAATCAGAGAAATCCACTGAGGTTGTGCCAAAGAAGAAGATCAAA
AAGGAGCAGGTTGAAACAGTTCCTCAGGCTACAGTGAAGACTGGATTACAGAAAGGTGCC
AGCGAGATTTCAGATTCCTGTAAACCTCTAAAGAAAAGGAGTCGCGCCTCAACTGATGTA
GAAATGACTAGTTCAGCATACAGAGACACATCTGACTCCGATTCTAGAGGACTGAGTGAC
CTGCAGGTAGGCTTTGGAAAGCAAGTAGATAGCCCTTCAGCTACTGCAGATGCAGACGTT
TCTGATGTGCAGTCCATGGATTCAAGTTTGTCGAGAAGAGGCACTGGAATGAGTAAGAAG
GACACTGTATGTCAGATTTGTGAAAGCTCTGGTGACTCTCTGATTCCTTGTGAGGGAGAG
TGCTGCAAACACTTTCACCTGGAGTGCCTGGGATTGGCATCACTTCCTGATAGCAAGTTC
ATCTGCATGGAATGTAAAACTGGGCAGCACCCATGTTTTTCGTGTAAAGTGTCTGGTAAA
GATGTGAAGCGTTGTTCTGTTGGTGCTTGTGGGAAATTTTATCATGAAGCCTGTGTCCGC
AAATTCCCCACTGCCATCTTTGAATCAAAAGGATTCCGCTGTCCTCAGCACTGCTGCTCT
GCCTGCTCTATGGAGAAAGATATCCACAAAGCAAGTAAAGGCCGCATGATGAGATGTTTA
AGATGTCCAGTTGCCTATCACTCTGGAGATGCTTGCATTGCGGCCGGAAGCATGTTAGTA
TCCTCCTACATTCTCATCTGTAGTAATCATTCCAAACGGAGCAGTAATTCTTCTGCTGTA
AATGTAGGCTTTTGTTTCGTTTGTGCCAGAGGGCTGATAGTTCAGGACCATTCAGACCCC
ATGTTCAGTTCATATGCCTATAAGTCCCACTACCTACTGAATGAATCAAATCGTGCTGAG
TTGATGAAATTACCTATGATTCCTTCTTCGTCAGCTTCCAAAAAGAAATGTGAGAAAGTT
ATTAAGACTGTTTATTTGTTTCAAGGTGGAAGATTGCTCTGCTGTGAATCGTGCCCAGCT
TCCTTCCACCCGGAATGCCTAAGCATAGAAATGCCAGAAGGCTGCTGGAATTGTAATGAC
TGTAAAGCTGGCAAGAAACTACATTACAAGCAGATTGTTTGGGTCAAATTGGGAAATTAC
AGATGGTGGCCAGCAGAGATCTGCAACCCCAGGTCTGTGCCACTGAACATCCAGGGCCTT
AAACATGACTTGGGGGACTTCCCTGTATTCTTCTTTGGTTCTCATGACTACTACTGGGTA
CACCAGGGCAGAGTGTTCCCTTATGTTGAAGGAGACAAAAGCTTTGCTGAAGGGCAGACT
AGTATTAACAAGACCTTCAAAAAGGCACTGGAAGAAGCTGCAAAACGTTTCCAGGAATTG
AAAGCACAAAGAGAAAGTAAAGAAGCCCTAGAGATTGAAAAAAACTCAAGAAAACCCCCT
CCCTACAAACACATCAAAGCTAACAAAGTAATAGGAAAGGTGCAGATCCAGGTTGCTGAC
CTGTCAGAGATTCCCCGCTGTAACTGCAAGCCAGCTGATGAAAACCCTTGTGGCTTGGAA
TCGGAGTGCCTGAACAGAATGTTGCAGTATGAATGCCACCCGCAGGTGTGCCCAGCTGGA
GATCGTTGTCAGAACCAGTGCTTTACAAAGAGACTATACCCTGATGCAGAGATCATCAAA
ACGGAGCGGAGAGGCTGGGGCCTCAGGACCAAAAGGAGCATTAAGAAGGGTGAATTTGTA
AATGAATACGTCGGTGAATTAATTGATGAAGAAGAATGCAGATTGCGAATCAAGCGAGCC
CACGAGAACAGTGTAACTAATTTTTATATGTTAACTGTTACCAAGGACCGTATAATTGAT
GCCGGCCCAAAAGGAAATTATTCTCGCTTCATGAACCACAGTTGTAATCCCAACTGTGAA
ACACAAAAGTGGACAGTGAATGGAGATGTTCGAGTGGGACTATTTGCTCTCTGTGATATT
CCTGCAGGGATGGAGTTAACATTTAATTATAACCTAGATTGTCTGGGCAACGGCAGAACG
GAGTGCCACTGTGGAGCAGATAACTGCAGTGGTTTTCTAGGAGTGCGGCCAAAGTCGGCA
TGTGCGTCAACAAATGAAGAGAAGGCAAAAAATGCTAAGTTAAAACAGAAGAGACGAAAG
ATCAAAACAGAACCAAAGCAGATGCATGAAGATTACTGTTTTCAATGTGGAGATGGTGGA
GAGCTGGTCATGTGTGACAAAAAAGACTGTCCCAAAGCATACCACCTCCTATGCCTTAAC
CTGACTCAGCCACCATATGGAAAGTGGGAGTGTCCGTGGCATCAGTGCGATGAGTGCAGC
AGTGCAGCTGTTTCCTTCTGTGAATTCTGTCCACATTCATTTTGTAAAGATCATGAAAAG
GGGGCCCTGGTTCCCTCTGCACTGGAAGGCCGCCTCTGCTGCTCGGAACATGACCCCATG
GCTCCTGTGTCACCAGAATACTGGAGCAAGATAAAATGTAAATGGGAATCACAAGATCAT
GGAGAAGAAGTAAAAGAATAAATGTGTGGTGTCCCCTCCTTTCTATTTAAGTGAAAAAAG
CAAATAGATCATGCATTTAAAAAGAAGAGACTGCTACAGTGCATACAGCCTTTGCCATCG
GAACTGCCTTATTAAAGCAAAAATGGGAAACCAGTTCATGCAGGCAGAAGCAGTTGGTGG
TGTCTGGTTTTTGTTTGATTTGGTTGGTTTGGGATTCTTTTGTGGAGGGTTAAATTCCCT
TGGTCTTTTCTTGCCTTTTATTGTGCTTCAGTGCCATTGCAGCTTGAAAAAGAAATGTTT
TTGCTGTTAAAATAAGAACAAAGAGAAAAGTAAGTTTTGTTAATGAGATAAATTTAAAGT
CTAAGATGTGTTCCTTGGTTGTATAAAGCAAAAGTAGCCATCATTCCTTTATTTATTTTC
ATTTTTAGGAATTTCAAGAAGTGTAGTTCAATAGTCTAATCAAGTGTGTGTGTGTTTTAA
GTAGGAATCTGAGAAAGCCCTCTAGGAAAGGGTATGATAAGCTTTATATACCTCTTTACT
GAGCAGTAGGTAGGCTCACTTCTCTTTCCCTTCAAAATGCTTTTCATAGGCTTAGAGAAG
GGCTCTATGGAAGTATTAAATCTGGCCTCTTGAAAACAATGCCTCGGTGGATTTTACCTC
TGTGGTCTTAAACAAGGTGGGCTTTGTACTATGGTAACTTTACCTAGAAGGGTATATGGT
GTGTTTCCTTGGTGGAAGGAAAAAAAGGAATGGATGTGCTCACTGATTTTTAAAACGTTT
TCCATTGACATGGATGGTTTGGGTTTTGGATGAAGTGCGTTTCTGTGGATATGAAGCATA
GTTGGAATGGTCACTCCTATTTTCCTGACACTGATTAAGGCAGCTAAAGGGGGATGAAGG
CATAAACCAAAATTTGGATCATATAAGCACCATTTTCTGTCCAATTTTATTGTAGACCCT
GGTCTTAATTGGAGAGAATTACAGGCATTTTATTTTTTGTCTCTGTTTTCCTCTCCTACT
CAAACATTTCTTTTGTCATCTGACCATTCAGTCATGTTTCCTGGTAAAACCACACAAGTG
AGTTTGAATTGTATTTGAATAGATCTTTTTGGTTGAGTTCCTAATTTGGGGGGTGAAAGT
AGTAGGGGCATCCCCAGGTTACATGTAAAGAATTTCTATTATTATCCAGTACTTAAGATT
GCTCCCATTGAGTAAGGGGAAGAACTTCTACTTTTACAGGGTGCATAAGAGCCACACAAA
CACACTTCATCTTAGGAAGCACTTGGAGAAAACTCCCAAGAAAGTCAGTGTTAGCAAAAA
TGGTTGATGGTGATGCTTGACTCTTATAGATGCGAGTATACCAAGATGTCTGCTCACCAA
ACTCACTTGCTTTTAATGCTTAGGAATATGTATATTCCAGTATTCCTTGTATGAAAATAA
TTAGTAATGTCAGACATTGTTGTAACACTGTACTAAGTAGAAGTCTAGGGTTAGCTTGAA
TGAATGTTAACTTTCTCTGTGAATTTTGACTGCTTACAATTGCTGGTACCTGGTAGCATT
TATTTTCCCTCAAGTACCTAGTAACCTTATGAAGGTAGGGAGGGTAGATGCTCTACCACA
TTCCTTCAGCTGTATTGAGTGTTCCATTTGCTTATCAATTTAGAGCTCTTCTATGGAAAG
AGGGTGAAAATCTGTTTTGTGCCTCTTTTTTTTGTATGTAAATGTGCAATTATACTGGAT
TTTCTCTTGTAAAAAACACTACAATTCTTTTACTGAAGCTCCTAAACTGCCATTTGCCTG
ACTCCAGCAATTAATTCTGCGGTGACTCATTGGGCTTCCAGTACTTCTGTTGATTAGATA
TGGTCCCAAAAGAAAGAGCAAAATGGAAAATGCGATCCATGTCACCAAATATAATTGCTA
CAAGTAACATGAAATACAGCTCACCAAAACACTAAACTTTGCTCTTGAGCAATTATATAG
TTTGATGTCCTTTTAAAAAATAAGAAAAGCTAGGTTTTATCATACTAAAATTTTATTTTG
TATATGATGTTTGGTTTTTTAAACTTACTAACATAAGGATTTCCTTTAATATTCCAAATA
CAGTTCTTGAAACAGTATCCAACATGAAATCTTATCTCCTTGCTTTTAGACTTAGTGCTA
TTTACTATCTAAAGACTTTTCTATGGTAAGCCAGGGTACATCCTATATACTACAGATACC
TTAGGTTTCAGTATTTTTATGCAGCTTCTTCATTGTGTCACATTTTGTTTTCATATCTGT
AACAGAGCTCTGCTGAAATTAAAAAAAAATTATGATTAATAGGATTGTTTCACCATTTCA
GAAATCAGAGTAGAAAACAAAATAGCTGCCAGGTGCAGTGGCTCACACCTGTAATCCCAG
CACTTTGGGAGGCCGAGGTGGGCAGATCATGAGGTCAGGAGTTTGAGACCAGCCTGACCA
ACATGGTGAAACCCTGTCTCTGCTAAAAATACAAAAAGGAGCCGGGCATGGTGGCACATA
CCTGTAGTCCCAGTTTCTCAGGAGGCAGAGGTTGCAGTGAGCCAAGATCACATCACTGCA
CTCCAGCCTGGGTGACAGAGCGAGACTCCATCTCAAAAAAAAAAGGTAACCATAGTTCTG
AAGTCTTTGGCCATGAATGTTCTTTAATGGTCTAAAAAGCGGTTTTAGTCATGCTGGTGC
CAAGGAGTTCTCCTCACACCTCCATAGCGTCAATGTTGACCTATTTGATATATTTTTAAG
TTGCAGATTATAGATGCAGAAAGAGAAAATTGTCCTTTATGTGTGCATGAGTATACATGC
ACTGTGCCTGTGATACACCAATGAAATATTCCAAAAGACATTGCTCACTCATAGTCTGAA
GTTGGTATTTGTTAACTTTTAAATCTATATGTGGTCAGAGTGTAAGTGGCTGGTTTTTAT
TCTTGTCCAACAATGAAATAACTTAAAGCAGCATGGGCTAATGGTGGTATTTTTTTTAAC
CACATGTTAATTTGTTGAAGGAAGAAGTGAACATAAGATTTTTGATAATCAGCCTAAAGC
TTCAGAAACTGGATCAGTAAGAGCTAAAGATGAAATCCTGGGAAACTTTCTCAGGCACTG
TGCAGGGGAGGGAGGGGCTGGACCGCCACTGCTGCGAGGGAAGAATCAGAAGAGCTGCCT
GTGGCTGGCTGAGAAGGGCAAGGTGGATGGCTCTTCATTCCTGGAAGGCTGAAGCAGCCA
GAGGCAGTGATTCACCTCTTTAATGTCTAATCAGGGAGAGATACAGGAGTGAGGTGGGTT
TTATTTTCATTTTTGTTTTAACAAGTTCCCACTCTTATCTTAATTCTCAAAAATGATCTG
GCCTCATCTATAGAACTGGCTGAGTTGGGGAATCATTTAAAATTTGGGATTTTCTGTACA
AGTCAAGAACATATGTGAAAGCTAAAAAAGTAATGGAGGCAGGGGGACTGCTCCCAGCTC
CCTTCTGCCATTTACACAAAATATTTGAAAACATGTCTGTAAATAACGTTGTGGAACTGA
GATATTGAGTATCTAATCATGTAAAGGACCCTCAGATGGGACAGGCTATTGGACAACTTT
CCTGGTTCATGAAGTGGAATTTCCTTTTTGAGTAGTTTCTTGCATGGTGTATTCCAATAG
GTCAAACCCAGACCTACTGTTTGCAAACAGGCCATCTGTAGAGAATACAATCTCTGGACT
GCCCAGGACTTGTTGCTTGTCTTTCATTTCATTTTAAATACAAAGCTCTTCCTTTAGCAT
TCACCTTGAAGTCAAGGTGTTGGCTGCCACATGCCATGTCCTCTTAACAAGATAAGAAAA
CAGTGGCTATGGAGCCCTCACAGCTGGGAAGCTGACATTCTATACTTCCATATGAGAAAA
AGGACATTGGAAAGTTGCTTTATTTCTGGGCAGCGTAGACTAAAGTTACTTTTCACAAGG
CTGATGCATCCAGCCTCCCCCAGTTGTCCAAGTTGGTGCAGACATGAATTGATGAATGGA
AACACTTTCCTTTGGCCTAGGGCCACCTAGAATTGGTCTCTGGTTATTTGTAAAACAAAA
AGTAGAACTTGCTTCCATTTTCAGATGGACTAGGGAATACTATAATTAGACAGCTTTGCA
ATGAATTAACAAATACTGAAAAGTTGGAAATGTGTATATACTGAAATCTCACCAACTTTT
ACCTGGGGTGGGGTACCAGGAGAAAGGGAACCCCCTTTCTCCTGGTAAAGGGTAAGGGGG
GGGATAATGTTTACCACAGGTACGAAATAGTCACTTTAACATTGAGACCTCTGCCTCATT
GAATTCAGGTTTTTTAAGTACTTGAAACTCTTCAGATTCTCCTTATTTTAGTTTCTTTTT
ACATTTATGAAGTAGAAAGCATTGTTTTGTAAACTGTTTTGAAAATAAATAGCCTAGTCT
CTTATCCTCTTTAGCGTGGATTAAAGGTGAAGTTCTGCAAATGGGAGAGTGTTCACAGTA
GATAGCTCAGATTGATTGAACACATTTGAGGAAGAGACTCCTGCATGAGATACCAGCATT
TTTACAAATACTTTTTATGTACATTCTTTATTTTGTCATTTTGTCAACCCTCTCCCCAAG
CACATCTTCTTTCCTTTTACTATGTCTATGTAGGGAAAAAAACAAAACAAAAAATTGCAC
TTACGTTACACTCCCAAAATGTGGGTAATCCGTGTCTTTCAAAAAACATTTCTGTTTTTT
GTTTTGTTTTGGTCAGTCCATTGCATAAGTGACAAGTTTGGGTGCTTGTGGCACGTATGT
ATGAAGCGGGAGGGGGATGAGAATTGCCTGTCCTTCAGTAGGCTGTAAAAGTAATTTACA
TGTAAGTAAAAAGGGAAAATAGAATAGATGCCAAAGTCATTTATTCAGTCCTTAGTTTTC
TTATGTGGCATTACTGCATCTGCTAGTTAGTGAGAAAGCACCCTCAGCTTTTACTGCTCC
CCTCCCTGCCTGCCAACACACTTGATGTGTGCAAACAGCCCTCAAGTATCTGTCAGATGA
CCTATATAAGGTATTGAATAAGGTATTCTTGTCAGTTTAGAAATGGACTGGATAAAACTT
ACTTGGTTGTCATTATTTTATCTCATTTGTCCTGTTACATGCCCTATGTTAAGATAATTA
TATTGCCACTAATAATCAAGATGCTAAATGAGTATTACAACTGGCTAATATCATTTTTTA
TATACAAGGGTATGTGTATATTTGGAATTGATATGAGAAACTCATTTGTACCCATTTGAG
TGATATTGCACAACAAACACAGATACCTACAGACTCCGTTTTCATTTTCTCGTGTTCTTT
ATGATAATGATCTTTGTAGATTGGTTATTTCTGTACTTTATCTGTAATAAACTTTGTAGA
TCCTGTGAACCATTACTTTGCCTAAATCACTTGAGACTTGAGTCTTTAATAACAAAGCAT
CAATATTCACTAAAGTCAATCTCTTTTGAGTTTCTGTGACTTGGCTAGAAGCTCTTGACA
CTAAGGGATTAGTGTTAATTTTCCCTGGGGGTGTTCCACTAGGGCATTACTGTATAATGA
CTTGATGTTGCCACATAGACTTCAAGATATATAATATTTTGAGGATTTTGTTGATTGGCC
TATGTTTTATTGCATAGTGTGAAACGTGTAAAGCTTGGTTAACCTGTATATAGATAGCTT
ATTGTTGACTAGTTATAGTGTATTTAGGGTTGCCTGTAATATTTAAGCTTCTTTACTGAT
GTGTGTGCTGGTAGGAACATATAATTTTTGTACATTATATTTACTGAGATGTTGCCTTTT
TTATTTTACAAATACTTTGGAATTCCAATGTGTTTTTTGCTTCCGTGAGGATTAATTTGG
AAAGGTTTTTAATGACATTCCACTGATTTCAGATTTTGCTTGAGATTGACTTCAATAAAT
TGTCCTGTATGTTCCAAATTAAA

Protein Sequence

>54904 : length: 1446
MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEDAFDNNSDIAEDGGQTPYEATLQQGFQYP
ATTEDLPPLTNGYPSSISVYETQTKYQSYNQYPNGSANGFGAVRNFSPTDYYHSEIPNTR
PHEILEKPSPPQPPPPPSVPQTVIPKKTGSPEIKLKITKTIQNGRELFESSLCGDLLNEV
QASEHTKSKHESRKEKRKKSNKHDSSRSEERKSHKIPKLEPEEQNRPNERVDTVSEKPRE
EPVLKEEAPVQPILSSVPTTEVSTGVKFQVGDLVWSKVGTYPWWPCMVSSDPQLEVHTKI
NTRGAREYHVQFFSNQPERAWVHEKRVREYKGHKQYEELLAEATKQASNHSEKQKIRKPR
PQRERAQWDIGIAHAEKALKMTREERIEQYTFIYIDKQPEEALSQAKKSVASKTEVKKTR
RPRSVLNTQPEQTNAGEVASSLSSTEIRRHSQRRHTSAEEEEPPPVKIAWKTAAARKSLP
ASITMHKGSLDLQKCNMSPVVKIEQVFALQNATGDGKFIDQFVYSTKGIGNKTEISVRGQ
DRLIISTPNQRNEKPTQSVSSPEATSGSTGSVEKKQQRRSIRTRSESEKSTEVVPKKKIK
KEQVETVPQATVKTGLQKGASEISDSCKPLKKRSRASTDVEMTSSAYRDTSDSDSRGLSD
LQVGFGKQVDSPSATADADVSDVQSMDSSLSRRGTGMSKKDTVCQICESSGDSLIPCEGE
CCKHFHLECLGLASLPDSKFICMECKTGQHPCFSCKVSGKDVKRCSVGACGKFYHEACVR
KFPTAIFESKGFRCPQHCCSACSMEKDIHKASKGRMMRCLRCPVAYHSGDACIAAGSMLV
SSYILICSNHSKRSSNSSAVNVGFCFVCARGLIVQDHSDPMFSSYAYKSHYLLNESNRAE
LMKLPMIPSSSASKKKCEKVIKTVYLFQGGRLLCCESCPASFHPECLSIEMPEGCWNCND
CKAGKKLHYKQIVWVKLGNYRWWPAEICNPRSVPLNIQGLKHDLGDFPVFFFGSHDYYWV
HQGRVFPYVEGDKSFAEGQTSINKTFKKALEEAAKRFQELKAQRESKEALEIEKNSRKPP
PYKHIKANKVIGKVQIQVADLSEIPRCNCKPADENPCGLESECLNRMLQYECHPQVCPAG
DRCQNQCFTKRLYPDAEIIKTERRGWGLRTKRSIKKGEFVNEYVGELIDEEECRLRIKRA
HENSVTNFYMLTVTKDRIIDAGPKGNYSRFMNHSCNPNCETQKWTVNGDVRVGLFALCDI
PAGMELTFNYNLDCLGNGRTECHCGADNCSGFLGVRPKSACASTNEEKAKNAKLKQKRRK
IKTEPKQMHEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQCDECS
SAAVSFCEFCPHSFCKDHEKGALVPSALEGRLCCSEHDPMAPVSPEYWSKIKCKWESQDH
GEEVKE