ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

54894

Name

RNF43

Synonym

RNF124|URCC;ring finger protein 43;RNF43;ring finger protein 43

Definition

E3 ubiquitin-protein ligase RNF43

Position

17q22

Gene Type

protein-coding

External Links

Links to cell senescence gene database

54894

Links to epithelial mesenchymal transition gene database

54894

Links to ovarian cancer gene database

54894

Links to endometrial cancer gene database

54894

Links to iHOP

54894

Sequence Information

Nucleotide Sequence

>54894 : length: 5746
GGAGTCAGAGCTAGAACACCAATTACAAACCACAGGCTTCCTGCTCTAGGGAGTTGATCC
AGAATTGTCTTTCTGAAAGGAAGCACTCGGAATCCTTCCGAACTTTCCAAGTCCATCCAT
GATTCAGAGATACTGCCTTCTCTCTCTCTGGGATTTTATGTGTTTCTGATAGTGAATTGT
TGATGTATTTGCTACTTTGCTTCTTTTCTCTTTCAAGACTTGATCATTTTATATGCTGTT
TGGAGAAAAAAAGAACTTTTGTTAGCAAGGAGGTTTCAGAAATGATTTTGGATTTTCTGT
AAGTGTTTAATTTAGTTCTAGGGGACAGCATCTCTCATCCCGGAGTAAATTTCTGCCTTT
GACCTGCATGGATTATTTTTTCAGGCTGCGGAATTTCTCGGCACCTACCTGTAGTATGGG
GCACTTGGTTTGGTTGCAGAGTAAGAAGGTGGAAGAATGAGCTGTACTTGGTTAAGCAGT
TGAAACCTTTTTTGAGCAGGATCTGTAAAAGCATAATTGAATTTGTTTCACCCCCGTGGA
TTCCAGTGGGCCCGACAGCGCAACAGTGCCTGGCAACTTGATGCATATGGAAGAGCAATG
CCAAGTGATCTGACATAATACAAATTCACGAAGTGACATTCAATCACAAGCAAAGTTGGA
AATTCCAAAGAGAAGTGGTGAGATCTTTACTAGTCACAGTGAAGATGGGAGAAAATGACA
TACCTGCAGCAGATGTGGGCTGAAAATATCCTCTTCTCTGCCCAATCAGGAATGCTACCT
GTTTTTGGGAATAAACTTTAGAGAAAGGAAGGGCCAAAACTACGACTTGGCTTTCTGAAA
CGGAAGCATAAATGTTCTTTTCCTCCATTTGTCTGGATCTGAGAACCTGCATTTGGTATT
AGCTAGTGGAAGCAGTATGTATGGTTGAAGTGCATTGCTGCAGCTGGTAGCATGAGTGGT
GGCCACCAGCTGCAGCTGGCTGCCCTCTGGCCCTGGCTGCTGATGGCTACCCTGCAGGCA
GGCTTTGGACGCACAGGACTGGTACTGGCAGCAGCGGTGGAGTCTGAAAGATCAGCAGAA
CAGAAAGCTATTATCAGAGTGATCCCCTTGAAAATGGACCCCACAGGAAAACTGAATCTC
ACTTTGGAAGGTGTGTTTGCTGGTGTTGCTGAAATAACTCCAGCAGAAGGAAAATTAATG
CAGTCCCACCCGCTGTACCTGTGCAATGCCAGTGATGACGACAATCTGGAGCCTGGATTC
ATCAGCATCGTCAAGCTGGAGAGTCCTCGACGGGCCCCCCGCCCCTGCCTGTCACTGGCT
AGCAAGGCTCGGATGGCGGGTGAGCGAGGAGCCAGTGCTGTCCTCTTTGACATCACTGAG
GATCGAGCTGCTGCTGAGCAGCTGCAGCAGCCGCTGGGGCTGACCTGGCCAGTGGTGTTG
ATCTGGGGTAATGACGCTGAGAAGCTGATGGAGTTTGTGTACAAGAACCAAAAGGCCCAT
GTGAGGATTGAGCTGAAGGAGCCCCCGGCCTGGCCAGATTATGATGTGTGGATCCTAATG
ACAGTGGTGGGCACCATCTTTGTGATCATCCTGGCTTCGGTGCTGCGCATCCGGTGCCGC
CCCCGCCACAGCAGGCCGGATCCGCTTCAGCAGAGAACAGCCTGGGCCATCAGCCAGCTG
GCCACCAGGAGGTACCAGGCCAGCTGCAGGCAGGCCCGGGGTGAGTGGCCAGACTCAGGG
AGCAGCTGCAGCTCAGCCCCTGTGTGTGCCATCTGTCTGGAGGAGTTCTCTGAGGGGCAG
GAGCTACGGGTCATTTCCTGCCTCCATGAGTTCCATCGTAACTGTGTGGACCCCTGGTTA
CATCAGCATCGGACTTGCCCCCTCTGCATGTTCAACATCACAGAGGGAGATTCATTTTCC
CAGTCCCTGGGACCCTCTCGATCTTACCAAGAACCAGGTCGAAGACTCCACCTCATTCGC
CAGCATCCCGGCCATGCCCACTACCACCTCCCTGCTGCCTACCTGTTGGGCCCTTCCCGG
AGTGCAGTGGCTCGGCCCCCACGACCTGGTCCCTTCCTGCCATCCCAGGAGCCAGGCATG
GGCCCTCGGCATCACCGCTTCCCCAGAGCTGCACATCCCCGGGCTCCAGGAGAGCAGCAG
CGCCTGGCAGGAGCCCAGCACCCCTATGCACAAGGCTGGGGACTGAGCCACCTCCAATCC
ACCTCACAGCACCCTGCTGCTTGCCCAGTGCCCCTACGCCGGGCCAGGCCCCCTGACAGC
AGTGGATCTGGAGAAAGCTATTGCACAGAACGCAGTGGGTACCTGGCAGATGGGCCAGCC
AGTGACTCCAGCTCAGGGCCCTGTCATGGCTCTTCCAGTGACTCTGTGGTCAACTGCACG
GACATCAGCCTACAGGGGGTCCATGGCAGCAGTTCTACTTTCTGCAGCTCCCTAAGCAGT
GACTTTGACCCCCTAGTGTACTGCAGCCCTAAAGGGGATCCCCAGCGAGTGGACATGCAG
CCTAGTGTGACCTCTCGGCCTCGTTCCTTGGACTCGGTGGTGCCCACAGGGGAAACCCAG
GTTTCCAGCCATGTCCACTACCACCGCCACCGGCACCACCACTACAAAAAGCGGTTCCAG
TGGCATGGCAGGAAGCCTGGCCCAGAAACCGGAGTCCCCCAGTCCAGGCCTCCTATTCCT
CGGACACAGCCCCAGCCAGAGCCACCTTCTCCTGATCAGCAAGTCACCAGATCCAACTCA
GCAGCCCCTTCGGGGCGGCTCTCTAACCCACAGTGCCCCAGGGCCCTCCCTGAGCCAGCC
CCTGGCCCAGTTGACGCCTCCAGCATCTGCCCCAGTACCAGCAGTCTGTTCAACTTGCAA
AAATCCAGCCTCTCTGCCCGACACCCACAGAGGAAAAGGCGGGGGGGTCCCTCCGAGCCC
ACCCCTGGCTCTCGGCCCCAGGATGCAACTGTGCACCCAGCTTGCCAGATTTTTCCCCAT
TACACCCCCAGTGTGGCATATCCTTGGTCCCCAGAGGCACACCCCTTGATCTGTGGACCT
CCAGGCCTGGACAAGAGGCTGCTACCAGAAACCCCAGGCCCCTGTTACTCAAATTCACAG
CCAGTGTGGTTGTGCCTGACTCCTCGCCAGCCCCTGGAACCACATCCACCTGGGGAGGGG
CCTTCTGAATGGAGTTCTGACACCGCAGAGGGCAGGCCATGCCCTTATCCGCACTGCCAG
GTGCTGTCGGCCCAGCCTGGCTCAGAGGAGGAACTCGAGGAGCTGTGTGAACAGGCTGTG
TGAGATGTTCAGGCCTAGCTCCAACCAAGAGTGTGCTCCAGATGTGTTTGGGCCCTACCT
GGCACAGAGTCCTGCTCCTGGGAAAGGAAAGGACCACAGCAAACACCATTCTTTTTGCCG
TACTTCCTAGAAGCACTGGAAGAGGACTGGTGATGGTGGAGGGTGAGAGGGTGCCGTTTC
CTGCTCCAGCTCCAGACCTTGTCTGCAGAAAACATCTGCAGTGCAGCAAATCCATGTCCA
GCCAGGCAACCAGCTGCTGCCTGTGGCGTGTGTGGGCTGGATCCCTTGAAGGCTGAGTTT
TTGAGGGCAGAAAGCTAGCTATGGGTAGCCAGGTGTTACAAAGGTGCTGCTCCTTCTCCA
ACCCCTACTTGGTTTCCCTCACCCCAAGCCTCATGTTCATACCAGCCAGTGGGTTCAGCA
GAACGCATGACACCTTATCACCTCCCTCCTTGGGTGAGCTCTGAACACCAGCTTTGGCCC
CTCCACAGTAAGGCTGCTACATCAGGGGCAACCCTGGCTCTATCATTTTCCTTTTTTGCC
AAAAGGACCAGTAGCATAGGTGAGCCCTGAGCACTAAAAGGAGGGGTCCCTGAAGCTTTC
CCACTATAGTGTGGAGTTCTGTCCCTGAGGTGGGTACAGCAGCCTTGGTTCCTCTGGGGG
TTGAGAATAAGAATAGTGGGGAGGGAAAAACTCCTCCTTGAAGATTTCCTGTCTCAGAGT
CCCAGAGAGGTAGAAAGGAGGAATTTCTGCTGGACTTTATCTGGGCAGAGGAAGGATGGA
ATGAAGGTAGAAAAGGCAGAATTACAGCTGAGCGGGGACAACAAAGAGTTCTTCTCTGGG
AAAAGTTTTGTCTTAGAGCAAGGATGGAAAATGGGGACAACAAAGGAAAAGCAAAGTGTG
ACCCTTGGGTTTGGACAGCCCAGAGGCCCAGCTCCCCAGTATAAGCCATACAGGCCAGGG
ACCCACAGGAGAGTGGATTAGAGCACAAGTCTGGCCTCACTGAGTGGACAAGAGCTGATG
GGCCTCATCAGGGTGACATTCACCCCAGGGCAGCCTGACCACTCTTGGCCCCTCAGGCAT
TATCCCATTTGGAATGTGAATGTGGTGGCAAAGTGGGCAGAGGACCCCACCTGGGAACCT
TTTTCCCTCAGTTAGTGGGGAGACTAGCACCTAGGTACCCACATGGGTATTTATATCTGA
ACCAGACAGACGCTTGAATCAGGCACTATGTTAAGAAATATATTTATTTGCTAATATATT
TATCCACAAATGTGGTCTGGTCTTGTGGTTTTGTTCTGTCGTGACTGTCACTCAGGGTAA
CAACGTCATCTCTTTCTACATCAAGAGAAGTAAATTATTTATGTTATCAGAGGCTAGGCT
CCGATTCATGAAAGGATAGGGTAGAGTAGAGGGCTTGGCAATAAGAACTGGTTTGTAAGC
CCCTAAAAGTGTGGCTTAGTGAGATCAGGGAAGGAGAAAGCATGACTGGATTCTTACTGT
GCTTCAGTCATTATTATTATACTGTTCACTTCACACATTATCATACTTCAGTGACTCAGA
CCTTGGGCAAATACTCTGTGCCTCGCTTTTTCAGTCCATAAAATGGGCCTACTTAATAGT
TGTTGCAGGACTTACATGAGATAATAGAGTGTAGAAAATATGTTCCAAAGTGGAAAGTTT
TATTCAGTGATAGAAAACATCCAAACCTGTCACAGAGCCCATCTGAACACAGCATGGGAC
CGCCAACAAGAAGAAAGCCCGCCCGGAAGCAGCTCAATCAGGAGGCTGGGCTGGAATGAC
AGCGCAGCGGGGCCTGAAACTATTTATATCCCAAAGCTCCTCTCAGATAAACACAAATGA
CTGCGTTCTGCCTGCACTCGGGCTATTGCGAGGACAGAGAGCTGGTGCTCCATTGGCGTG
AAGTCTCCAGGGCCAGAAGGGGCCTTTGTCGCTTCCTCACAAGGCACAAGTTCCCCTTCT
GCTTCCCCGAGAAAGGTTTGGTAGGGGTGGTGGTTTAGTGCCTATAGAACAAGGCATTTC
GCTTCCTAGACGGTGAAATGAAAGGGAAAAAAAGGACACCTAATCTCCTACAAATGGTCT
TTAGTAAAGGAACCGTGTCTAAGCGCTAAGAACTGCGCAAAGTATAAATTATCAGCCGGA
ACGAGCAAACAGACGGAGTTTTAAAAGATAAATACGCATTTTTTTCCGCCGTAGCTCCCA
GGCCAGCATTCCTGTGGGAAGCAAGTGGAAACCCTATAGCGCTCTCGCAGTTAGGAAGGA
GGGGTGGGGCTGTCCCTGGATTTCTTCTCGGTCTCTGCAGAGACAATCCAGAGGGAGACA
GTGGATTCACTGCCCCCAATGCTTCTAAAACGGGGAGACAAAACAAAAAAAAACAAACTT
CGGGTTACCATCGGGGAACAGGACCGACGCCCAGGGCCACCAGCCC

Protein Sequence

>54894 : length: 869
MSGGHQLQLAALWPWLLMATLQAGFGRTGLVLAAAVESERSAEQKAIIRVIPLKMDPTGK
LNLTLEGVFAGVAEITPAEGKLMQSHPLYLCNASDDDNLEPGFISIVKLESPRRAPRPCL
SLASKARMAGERGASAVLFDITEDRAAAEQLQQPLGLTWPVVLIWGNDAEKLMEFVYKNQ
KAHVRIELKEPPAWPDYDVWILMTVVGTIFVIILASVLRIRCRPRHSRPDPLQQRTAWAI
SQLATRRYQASCRQARGEWPDSGSSCSSAPVCAICLEEFSEGQELRVISCLHEFHRNCVD
PWLHQHRTCPLCMFNITEGDSFSQSLGPSRSYQEPGRRLHLIRQHPGHAHYHLPAAYLLG
PSRSAVARPPRPGPFLPSQEPGMGPRHHRFPRAAHPRAPGEQQRLAGAQHPYAQGWGLSH
LQSTSQHPAACPVPLRRARPPDSSGSGESYCTERSGYLADGPASDSSSGPCHGSSSDSVV
NCTDISLQGVHGSSSTFCSSLSSDFDPLVYCSPKGDPQRVDMQPSVTSRPRSLDSVVPTG
ETQVSSHVHYHRHRHHHYKKRFQWHGRKPGPETGVPQSRPPIPRTQPQPEPPSPDQQVTR
SNSAAPSGRLSNPQCPRALPEPAPGPVDASSICPSTSSLFNLQKSSLSARHPQRKRRGGP
SEPTPGSRPQDATVHPACQIFPHYTPSVAYPWSPEAHPLICGPPGLDKRLLPETPGPCYS
NSQPVWLCLTPRQPLEPHPPGEGPSEWSSDTAEGRPCPYPHCQVLSAQPGEFSEGSGCGR
ERRLQLNISGQVKSANKGLMEAEKDTAEMTTKILNHRDSVSCWLECRNTPPLPGATPLVG
RSQGGPREVLVWLRHQKGTWKAGCDGSCL